[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : cbiP
DDBJ      :cbiP         cobyric acid synthase
Swiss-Prot:COBQ_AGRT5   RecName: Full=Cobyric acid synthase;

Homologs  Archaea  51/68 : Bacteria  431/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.23.16c.37.1e.50.1
:485 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   87->445 1c30B PDBj 2e-24 14.6 %
:RPS:SCOP  7->175 1xfiA  e.50.1.1 * 2e-19 19.0 %
:RPS:SCOP  250->439 1q7rA  c.23.16.1 * 2e-14 19.6 %
:HMM:SCOP  1->246 1byiA_ c.37.1.10 * 8.3e-50 35.7 %
:HMM:SCOP  255->450 1ka9H_ c.23.16.1 * 1e-36 31.2 %
:RPS:PFM   293->437 PF07685 * GATase_3 7e-20 45.7 %
:HMM:PFM   289->438 PF07685 * GATase_3 1.6e-45 43.9 148/158  
:HMM:PFM   6->226 PF01656 * CbiA 1.7e-30 23.8 172/194  
:BLT:SWISS 1->485 COBQ_AGRT5 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88521.1 GT:GENE cbiP GT:PRODUCT cobyric acid synthase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2810940..2812397 GB:FROM 2810940 GB:TO 2812397 GB:DIRECTION + GB:GENE cbiP GB:PRODUCT cobyric acid synthase GB:PROTEIN_ID AAK88521.1 GB:DB_XREF GI:15158036 GB:GENE:GENE cbiP LENGTH 485 SQ:AASEQ MTARVLMFQGTGSDVGKSLMVAGLARAFTRRGLSVVPFKPQNMSNNAAVTADGGEIGRAQALQARAAGVPLSVHMNPVLLKPQSETGAQVVVQGKIVGSAKAADYQHMKAGLMPRVLDSFEHLKQLADLVLVEGAGSASEINLRANDIANMGFARAADAPVILIGDIDRGGVIASLVGTREVLDDDDAAMIEGFIVNRFRGDPALFSDGMRMIAEKTDWSSIGLLPHFSDAAKLPAEDALGLSGPAQRKPSAKIRIAVPILPHISNFDDLDPLDMEPDVELIRVRPGETIPADCRLVLLCGSKSTIADLAVLKDAGLDIDIKAHVRRGGYVLGLCGGYQMLGKTVADPDGIEGPPATVEGLGLLDVDTVLTGDKRLVSVRGTSFDGVGLSGYEMHVGETTGIAGSLVFSTIDGHADGTISPDGRVFGTYIHGLFADDRQRSAWLERLGGQGTDLNYDAQVDAVLDRLAAHMEQHLDLDRLLAIAR GT:EXON 1|1-485:0| SW:ID COBQ_AGRT5 SW:DE RecName: Full=Cobyric acid synthase; SW:GN Name=cobQ; Synonyms=cbiP; OrderedLocusNames=Atu2808;ORFNames=AGR_C_5093; SW:KW Cobalamin biosynthesis; Complete proteome; Glutamine amidotransferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->485|COBQ_AGRT5|0.0|100.0|485/485| GO:SWS:NREP 2 GO:SWS GO:0009236|"GO:cobalamin biosynthetic process"|Cobalamin biosynthesis| GO:SWS GO:0006541|"GO:glutamine metabolic process"|Glutamine amidotransferase| SEG 57->68|graqalqaraag| RP:PDB:NREP 1 RP:PDB:REP 87->445|1c30B|2e-24|14.6|329/379| RP:PFM:NREP 1 RP:PFM:REP 293->437|PF07685|7e-20|45.7|138/151|GATase_3| HM:PFM:NREP 2 HM:PFM:REP 289->438|PF07685|1.6e-45|43.9|148/158|GATase_3| HM:PFM:REP 6->226|PF01656|1.7e-30|23.8|172/194|CbiA| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF07685|IPR011698| GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF07685|IPR011698| RP:SCP:NREP 2 RP:SCP:REP 7->175|1xfiA|2e-19|19.0|153/343|e.50.1.1| RP:SCP:REP 250->439|1q7rA|2e-14|19.6|179/202|c.23.16.1| HM:SCP:REP 1->246|1byiA_|8.3e-50|35.7|221/224|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 255->450|1ka9H_|1e-36|31.2|192/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 512 OP:NHOMOORG 485 OP:PATTERN ------1111111111-1-----1111111111111111111111111111111-1-111-111--11 ---11-11----1-11111-11--1111111111111111-111----------------11222121112----------11-----11-1-1-1---------1-1-----------------11111111111111111111-111111111111111111111111111111111111111111----1-----------------1-------1111---11111111---------------------------------11---------------------------------------------1----------111111111111111111111111---1111111111--111111--2111-122------11111---2222211111111111121111111-1--1111111111111111-111123311111111111-11-1113-------------------------------111------1111111111111111111111111111--1111211111111111111111-----------111-1111-11111111-111211111-----1-1-----------------------------2-111-11-11111-1111111111121----11-------1---2--------------------------------111--11-1111111111111111----------1------------------------111-1---------------------1---1111111111111111111----------11111111111111--11111---------1---1111--------1---------------------------1--11------11 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1----1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 465 STR:RPRED 95.9 SQ:SECSTR ##ccEEEEEEEcTTccHHHHHHHHHHHHHHTTccEEEEEEcTTccTTTTTccccccHHHHHHccHHHHHHHHccTTTccHHHHcEEcccEEEEEEEEEEcccccHHHHcccTTcccGGGcccccccccEEEEccccccccccTTccccHHHHHHHTTccEcEEEEcccHHHHHHHHHGGcccHHHHHHccEEEEEEEcccccHHHHHHHHHHcccTTcccHHHHcccccEEEccccccTTTcccccccGGGccEEEEEEccccHHHHHHHHHTTEEEEEEETTccHHHHHTTcccEEEEcccccccTTcccTTcHHHHHHHHHHHTccccEEEETHHHHHHHHHTTccEEEEEEEEEEEEEEEEETTTTEEEEEEEEEcEEcTTccTTcEEEEEccTTccTTEEEEEEETTTccEEEEEEccccEEEEccccccTTTHHHHHHHHHHHHHHHHT#####HHHHHHHHHHHHc############# DISOP:02AL 1-2| PSIPRED ccccEEEEEccccccHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccHHHHHHHHHcccccccccccEEEcccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEcccccccccHHHHccccccccccccccccEEEEEEcccccHHHHHHHHHcccEEEEEEcccccccccccEEEEccccHHHHHHHHHHHccHHHHHHHHHHccccEEEEHHHHHHHHHHHcccccccccccccccEEEccccEEEcccEEEEEEEEccccccEEEEEEEEEEEEEcccccccEEEEcccccccccccccEEEEEcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHc //