[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ccdA
DDBJ      :ccdA         cytochrome c-type biogenesis protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  278/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:214 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->171 PF02683 * DsbD 4e-23 46.3 %
:HMM:PFM   21->192 PF02683 * DsbD 9.5e-49 43.0 172/211  
:BLT:SWISS 1->158 CCDA_BACSU 1e-21 34.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87566.2 GT:GENE ccdA GT:PRODUCT cytochrome c-type biogenesis protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1783274..1783918) GB:FROM 1783274 GB:TO 1783918 GB:DIRECTION - GB:GENE ccdA GB:PRODUCT cytochrome c-type biogenesis protein GB:PROTEIN_ID AAK87566.2 GB:DB_XREF GI:159140200 GB:GENE:GENE ccdA LENGTH 214 SQ:AASEQ MAGVSVEQFRTEETAPRPEVRRAVLFSAFCFTLGFATVFVALGAGASTIGTLLRQNLDILAKIGGFIIILMGLNFLGVFRIGLFSREARFQGAGKPATLSGAYVMGLAFAFGWTPCIGPVLGAILGVAASRDTVGDGAMLLAVYSLGLAVPFWIAAAFSGSFMRFLVRFRRHLGLVEKLLGVLLVLTGLAFMSGFITNVAIWFQETFPILMQIG GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 1->158|CCDA_BACSU|1e-21|34.2|152/235| TM:NTM 5 TM:REGION 24->46| TM:REGION 61->83| TM:REGION 103->125| TM:REGION 140->162| TM:REGION 177->199| SEG 173->189|lglvekllgvllvltgl| RP:PFM:NREP 1 RP:PFM:REP 22->171|PF02683|4e-23|46.3|149/209|DsbD| HM:PFM:NREP 1 HM:PFM:REP 21->192|PF02683|9.5e-49|43.0|172/211|DsbD| GO:PFM:NREP 3 GO:PFM GO:0016020|"GO:membrane"|PF02683|IPR003834| GO:PFM GO:0017004|"GO:cytochrome complex assembly"|PF02683|IPR003834| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02683|IPR003834| OP:NHOMO 361 OP:NHOMOORG 291 OP:PATTERN -------------------------------------1--------1--1122-------------21 11--1111---11111111-14111111111121222213-111111-11113141-111--21-11121---------2-1111111---------------------------------------------------111111----1-------------------1-------------2-1-----2112222221212122211122112221311111------121------------------------------------------------1---2111111111111111111111111112---------1-1-211-111111111---111211--1--1-3111--11-11111-1111-----11111112221112122211111111112--1--2-1-311-11111111111112---3121211212---------------------------------------------1------------------------------------------------------1----1-----------1-----111-----------122121111--1-11-------------1-1111111-11--------2-----------------------------------------------------------------------------------------------------------------------------------------------1--11111--1---------------------------------------------------------------------1----------------1--------------------------------1------ ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,8-21,90-90,93-94,96-96| PSIPRED cccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcc //