[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ccmA
DDBJ      :ccmA         ABC transporter, nucleotide binding/ATPase protein (heme)
Swiss-Prot:CCMA_AGRT5   RecName: Full=Cytochrome c biogenesis ATP-binding export protein ccmA;         EC=3.6.3.41;AltName: Full=Heme exporter protein A;

Homologs  Archaea  68/68 : Bacteria  897/915 : Eukaryota  185/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:213 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->164 2it1B PDBj 2e-16 31.9 %
:RPS:PDB   3->190 2dwoA PDBj 3e-26 11.0 %
:RPS:SCOP  3->191 1q3hA  c.37.1.12 * 2e-24 17.7 %
:HMM:SCOP  3->197 1v43A3 c.37.1.12 * 4.6e-37 30.8 %
:RPS:PFM   42->161 PF00005 * ABC_tran 1e-08 36.1 %
:RPS:PFM   133->201 PF02463 * SMC_N 7e-05 38.2 %
:HMM:PFM   42->161 PF00005 * ABC_tran 3.2e-18 31.3 115/118  
:HMM:PFM   132->201 PF02463 * SMC_N 0.00052 31.9 69/220  
:HMM:PFM   14->49 PF00488 * MutS_V 1.2e-05 38.9 36/234  
:BLT:SWISS 1->213 CCMA_AGRT5 e-121 100.0 %
:PROS 133->147|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88407.1 GT:GENE ccmA GT:PRODUCT ABC transporter, nucleotide binding/ATPase protein (heme) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2671192..2671833 GB:FROM 2671192 GB:TO 2671833 GB:DIRECTION + GB:GENE ccmA GB:PRODUCT ABC transporter, nucleotide binding/ATPase protein (heme) GB:PROTEIN_ID AAK88407.1 GB:DB_XREF GI:15157900 GB:GENE:GENE ccmA LENGTH 213 SQ:AASEQ MDLTAENLGVRRGEDFIFMNISFKLSDGEALVLTGRNGSGKSTLLRTVAGLLRPEQGRVKIAGEGIDAEMRPSEAFHYLGHRNAMKTELTVAENLRFWKDFLGDFPGSTGVAIDEAAAIVGLAGITHLPFGYLSAGQQRRFAMAKLLVAWRPVWILDEPTAALDRAADAMFTDLVKSHLGKGGIVLAATHQPLGLEKAQELQMTGFAGVETWA GT:EXON 1|1-213:0| SW:ID CCMA_AGRT5 SW:DE RecName: Full=Cytochrome c biogenesis ATP-binding export protein ccmA; EC=3.6.3.41;AltName: Full=Heme exporter protein A; SW:GN Name=ccmA; OrderedLocusNames=Atu2686; ORFNames=AGR_C_4868; SW:KW ATP-binding; Cell inner membrane; Cell membrane; Complete proteome;Cytochrome c-type biogenesis; Hydrolase; Membrane; Nucleotide-binding;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->213|CCMA_AGRT5|e-121|100.0|213/213| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0017004|"GO:cytochrome complex assembly"|Cytochrome c-type biogenesis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 133->147|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->164|2it1B|2e-16|31.9|163/361| RP:PDB:NREP 1 RP:PDB:REP 3->190|2dwoA|3e-26|11.0|173/449| RP:PFM:NREP 2 RP:PFM:REP 42->161|PF00005|1e-08|36.1|119/123|ABC_tran| RP:PFM:REP 133->201|PF02463|7e-05|38.2|68/536|SMC_N| HM:PFM:NREP 3 HM:PFM:REP 42->161|PF00005|3.2e-18|31.3|115/118|ABC_tran| HM:PFM:REP 132->201|PF02463|0.00052|31.9|69/220|SMC_N| HM:PFM:REP 14->49|PF00488|1.2e-05|38.9|36/234|MutS_V| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0005524|"GO:ATP binding"|PF02463|IPR003395| GO:PFM GO:0005694|"GO:chromosome"|PF02463|IPR003395| RP:SCP:NREP 1 RP:SCP:REP 3->191|1q3hA|2e-24|17.7|181/265|c.37.1.12| HM:SCP:REP 3->197|1v43A3|4.6e-37|30.8|195/0|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 21485 OP:NHOMOORG 1150 OP:PATTERN FF95E98ABBBAB9DBS7AEBB9HKCFLFHGGA37764AAB96INELLBEfOK4CMDJKBD777E123 GFPC*OIHMMMKIGJHIFF-FN66LeFFFFFGPTTTXprtCUEfPcKMTJGCaQU8DH44PTWSZZUpxuQDBBBTECIBSMO4564465C836697--66A577IBJAA344444457622229DB6DG77F9GENOOSU889THPKUTGIKLNFGFADBFAGHPSacTC6C79736B6A84OHKFEGD2ILSdddeeckkUhkfcflWSPPOZehcMUVWNMNQSTRQSkyEFFFEFEDEEFFFEED9689QLEGNPHDJFNROBCXYIF8DMLCFDKKMJLJNWRROOOOLLPPOONIGGGFIHHHHHGGSLLFFGMLNMORUSVbbbbbXaMZNGWRSFJLIfMLMIbMNJBooRFJNNDEMMEKNE99GDMQKKCA7658LF*w*FGScbdgdZcYYaVeYYZ*-QSlQKmUZs*J4************sjBECck*pZmqocdEEEEEEEEcGKFHNKT3333333355442222223221223424278AA59PohTaeefgjkTUSURffy*aXXYLcji*WaaW58SRQbLPHHcacjuz8IO8D9APCBCEDEDCEHDFLELOdDIBOKGNPJHO7JJHHKKLJEIGEHTcKK8BDA589AA6224122111156166CAMKSCMGCAD9RDEIIFCKIHFFGIHGDILG2-AAGA9-1----cSkbEWKTWWTUVTURS-VTRSUTTSTSWUTSSSSSQiopgoKIHLQMNKLMMMLMKMKNLXONIQRORB-Wbccgddbcegg117A34444CCCCH5WObEDFJLG39A89B9ALBCCBC7676ARNPPNPQRVbYPRLMOXbc7666667668FONaMONNOTPNLNEEE9C9ABCD787823C9CC56661111-111S38442-4--14123211-1213-1111BJJA8HJIHD7MG --11EA6-GA22AE633311422323255211133314132123333334235424222212311131---12111--11-22222---9823111332121324-17J5ICDALDK85547H9ca3Q5l*P3PET9A83Q6BMG2E653N65nAG88N7J*7E783MEMhEDC45577*42375M8EM-NG35GGFD5 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 213-214| PSIPRED cEEEEEEEEEEEccEEEEEccccEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHccEEEEcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHccccHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHccEEEEEEccEEEEEc //