[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ccmB
DDBJ      :ccmB         ABC transporter, membrane spanning protein (heme)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  153/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:219 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->141 PF03379 * CcmB 4e-18 37.0 %
:HMM:PFM   1->215 PF03379 * CcmB 3.9e-79 49.5 214/215  
:BLT:SWISS 16->219 CCMB_BRAJA 5e-23 44.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88408.1 GT:GENE ccmB GT:PRODUCT ABC transporter, membrane spanning protein (heme) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2672036..2672695 GB:FROM 2672036 GB:TO 2672695 GB:DIRECTION + GB:GENE ccmB GB:PRODUCT ABC transporter, membrane spanning protein (heme) GB:PROTEIN_ID AAK88408.1 GB:DB_XREF GI:15157901 GB:GENE:GENE ccmB LENGTH 219 SQ:AASEQ MTVLFLRDIKLSIRAGGGALIGVLFFMTVVAVIPFGVGPDLNLLARIGPAIVWIGALLSALLGLDRLFQAERDDGSLDLILMQETPLVLTVFVKCLAHWVGTGLPLVLASPLLGLFMNMDEVAIGAVMLTLLVGSPAITFIGAVGAAVAVALPRGGLLVSILVLPLAIPVLIFGVSASYAAVQDPAPFMPPFFILCAITLFSAVTGPFFAALALRNVMD GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 16->219|CCMB_BRAJA|5e-23|44.6|204/222| TM:NTM 6 TM:REGION 15->37| TM:REGION 46->68| TM:REGION 91->113| TM:REGION 126->148| TM:REGION 158->180| TM:REGION 190->212| SEG 55->64|gallsallgl| SEG 103->115|glplvlaspllgl| SEG 142->172|gavgaavavalprggllvsilvlplaipvli| RP:PFM:NREP 1 RP:PFM:REP 4->141|PF03379|4e-18|37.0|138/214|CcmB| HM:PFM:NREP 1 HM:PFM:REP 1->215|PF03379|3.9e-79|49.5|214/215|CcmB| GO:PFM:NREP 4 GO:PFM GO:0015232|"GO:heme transporter activity"|PF03379|IPR003544| GO:PFM GO:0015886|"GO:heme transport"|PF03379|IPR003544| GO:PFM GO:0016020|"GO:membrane"|PF03379|IPR003544| GO:PFM GO:0017004|"GO:cytochrome complex assembly"|PF03379|IPR003544| OP:NHOMO 154 OP:NHOMOORG 153 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111-11111-1111111111111111-1111111111--1111111111111----1-111111--111111111111-1-1------------------------------------------------------------------111-11-1-------1----1--------------2--11-----------------------------------------------------------11-1-1111111111111-111111--111---1---------1---1-1---------------------------------11-------------------1---------111111111111---1---------1-------111-1111-111-----------1---------------1-----------11111111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 218-220| PSIPRED cHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHcHHHccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccHHHcccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //