[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ccmC
DDBJ      :ccmC         ABC transporter, membrane spanning protein (heme)
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  375/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:253 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   104->182 PF01578 * Cytochrom_C_asm 5e-04 30.3 %
:HMM:PFM   17->189 PF01578 * Cytochrom_C_asm 6.9e-35 24.3 169/214  
:BLT:SWISS 13->233 CCMC_BRAJA 4e-77 60.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88409.1 GT:GENE ccmC GT:PRODUCT ABC transporter, membrane spanning protein (heme) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2672770..2673531 GB:FROM 2672770 GB:TO 2673531 GB:DIRECTION + GB:GENE ccmC GB:PRODUCT ABC transporter, membrane spanning protein (heme) GB:PROTEIN_ID AAK88409.1 GB:DB_XREF GI:15157902 GB:GENE:GENE ccmC LENGTH 253 SQ:AASEQ MNEQIFTITKFSDLANPTRFLALAARILPWLAGLTALVLAAGLYLSFTTDGDYQQGYTVRIMYVHVPSAWLAMMCYSVMAVSAIGTLVWRHPLADVSHKAAAPIGAAFTLIALITGSLWGKPMWGTWWVWDARLTSVFVLFLMYLGLIALNRAMDDPSRAARVSAVLILVGFVNIPIIKFSVEWWNTLHQPASVIRMGGSAIDAEFLWPLLTMAIGFTLLFFTLHIAAMRNEIWRRRVAAQRRLAARMANREG GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 13->233|CCMC_BRAJA|4e-77|60.6|221/263| TM:NTM 6 TM:REGION 23->45| TM:REGION 62->84| TM:REGION 99->121| TM:REGION 132->154| TM:REGION 165->187| TM:REGION 208->230| SEG 31->45|lagltalvlaaglyl| SEG 235->251|rrrvaaqrrlaarmanr| RP:PFM:NREP 1 RP:PFM:REP 104->182|PF01578|5e-04|30.3|76/212|Cytochrom_C_asm| HM:PFM:NREP 1 HM:PFM:REP 17->189|PF01578|6.9e-35|24.3|169/214|Cytochrom_C_asm| GO:PFM:NREP 3 GO:PFM GO:0006461|"GO:protein complex assembly"|PF01578|IPR002541| GO:PFM GO:0008535|"GO:respiratory chain complex IV assembly"|PF01578|IPR002541| GO:PFM GO:0016020|"GO:membrane"|PF01578|IPR002541| OP:NHOMO 420 OP:NHOMOORG 390 OP:PATTERN 11-1--------------1----11------1-----------------11-1--------------- 1111----------------------------------------------------------1----------------111-----------------------11--1------------------------1-11112---11-------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------1--111111111111111111111111111111111-11111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1-----------------------111221111-11----1-1---11-----1-------121111-----1111111111-------------11-----------------------------11-111111111111111111111111111---111-------11--1-1111111-111-111111111111111111111111---2222222222222221111111111-111111111111---1-----1111111-1111111111111111-------1111111111121111111111----------1111111111111111222221231111111-111111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------1--2-2-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 191-204, 241-246, 248-253| PSIPRED cccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //