[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ccmG
DDBJ      :ccmG         thiol:disulfide interchange protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  413/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->159 1kngA PDBj 9e-45 58.1 %
:RPS:PDB   17->162 2ec4A PDBj 5e-23 10.3 %
:RPS:SCOP  29->156 1z5yE1  c.47.1.10 * 2e-35 39.4 %
:HMM:SCOP  14->156 1kngA_ c.47.1.10 * 8.7e-33 37.1 %
:RPS:PFM   19->142 PF08534 * Redoxin 4e-24 42.5 %
:HMM:PFM   21->144 PF08534 * Redoxin 1.1e-19 26.9 119/146  
:BLT:SWISS 1->162 CYCY_RHILV 7e-56 64.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88410.2 GT:GENE ccmG GT:PRODUCT thiol:disulfide interchange protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2673817..2674305 GB:FROM 2673817 GB:TO 2674305 GB:DIRECTION + GB:GENE ccmG GB:PRODUCT thiol:disulfide interchange protein GB:PROTEIN_ID AAK88410.2 GB:DB_XREF GI:159140583 GB:GENE:GENE ccmG LENGTH 162 SQ:AASEQ MLYDQDVNGLDISAIPSALIGTKAPALSLPPLEGSNLPALTDAAIKGKLTLVNVFASWCIPCRQEHPLLQELSKDSRITVVGINYKDKSDNALRFLGELGNPFAAIGIDPNGKAAIDWGVYGIPESYLVGADGTILYKKVGPFDARSIELDLLPAIAAATGK GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 1->162|CYCY_RHILV|7e-56|64.6|161/186| BL:PDB:NREP 1 BL:PDB:REP 24->159|1kngA|9e-45|58.1|136/144| RP:PDB:NREP 1 RP:PDB:REP 17->162|2ec4A|5e-23|10.3|146/171| RP:PFM:NREP 1 RP:PFM:REP 19->142|PF08534|4e-24|42.5|120/132|Redoxin| HM:PFM:NREP 1 HM:PFM:REP 21->144|PF08534|1.1e-19|26.9|119/146|Redoxin| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08534|IPR013740| RP:SCP:NREP 1 RP:SCP:REP 29->156|1z5yE1|2e-35|39.4|127/136|c.47.1.10| HM:SCP:REP 14->156|1kngA_|8.7e-33|37.1|140/144|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 612 OP:NHOMOORG 415 OP:PATTERN ------------------------------------------------------------------1- -1111--------------------------------1--1111------------------31------------------------11---211-----1---1--13---------------33--1112-2123333---12-------------------------------------11212----21333333321323332-122-13331311212------31------------------------------------------------------------------------------------------1-1-1--------------------1--1--1----1--1------1---21-111111111111111111111111111111111-11112111212-111112211111321124121111113111111111111121111111111---------------------111111122-211112-----------------1111221211-21----211---211----1-------221111---------------1-21-1--1--2111-----------------------------33-244313112222212111112111132---2222------11--1-11111111111-111111111111111111111111---2222222222222222111111111-111111111111---1-----1111321-2222222222222112-------1211311112111122221111---------22222111112222211333333342222-12-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 95.7 SQ:SECSTR #######cccccHHccHHHHcccccccccccHHHHHHTTTcccTTTccEEEEEEEcccccHHHHHHHHTTTcHHHHHHHHHTEEEEEEEcccHHHHHHHHHHHHHHTcHHHHHHHHHcccTTccEEEEEcccccEEEEEcccccHHHHHHHHHHHHHHHHHH DISOP:02AL 1-14,160-163| PSIPRED cccccccccccHHHcccccccccccccEEEcccccccEEEcHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHccccccEEEEcccHHHHHHHccccccEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHHccc //