[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : cheD.1
DDBJ      :cheD         methyl-accepting chemotaxis protein
Swiss-Prot:CHED_AGRT5   RecName: Full=Probable chemoreceptor glutamine deamidase cheD;         EC=3.5.1.44;

Homologs  Archaea  23/68 : Bacteria  245/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.194.1
:181 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->140 2f9zC PDBj 9e-25 42.9 %
:RPS:SCOP  9->148 2f9zC1  d.194.1.3 * 4e-33 39.6 %
:RPS:PFM   52->146 PF03975 * CheD 3e-25 54.7 %
:HMM:PFM   52->155 PF03975 * CheD 1.3e-36 48.1 104/111  
:BLT:SWISS 1->181 CHED_AGRT5 e-103 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86335.1 GT:GENE cheD.1 GT:PRODUCT methyl-accepting chemotaxis protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 511047..511592 GB:FROM 511047 GB:TO 511592 GB:DIRECTION + GB:GENE cheD GB:PRODUCT methyl-accepting chemotaxis protein GB:PROTEIN_ID AAK86335.1 GB:DB_XREF GI:15155455 GB:GENE:GENE cheD LENGTH 181 SQ:AASEQ MMEAAAKRVHIIQGEYKVVSDPDVVMTTILGSCVAACLRDPVAGLGGMNHFLLPGTGNVTGGDATRYGVHLMELLINGLLKQGARRDRLEAKVFGGAKTIASFSNVGEQNAIFAMQFLKDEGIPVISSSTGGDHGRKIEFWPVSGRARQHPLSGAETQKTVAMETRPVPAPKPVANDIEFF GT:EXON 1|1-181:0| SW:ID CHED_AGRT5 SW:DE RecName: Full=Probable chemoreceptor glutamine deamidase cheD; EC=3.5.1.44; SW:GN Name=cheD; OrderedLocusNames=Atu0521; ORFNames=AGR_C_918; SW:KW Chemotaxis; Complete proteome; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->181|CHED_AGRT5|e-103|100.0|181/181| GO:SWS:NREP 2 GO:SWS GO:0006935|"GO:chemotaxis"|Chemotaxis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 14->140|2f9zC|9e-25|42.9|126/154| RP:PFM:NREP 1 RP:PFM:REP 52->146|PF03975|3e-25|54.7|95/112|CheD| HM:PFM:NREP 1 HM:PFM:REP 52->155|PF03975|1.3e-36|48.1|104/111|CheD| GO:PFM:NREP 2 GO:PFM GO:0006935|"GO:chemotaxis"|PF03975|IPR005659| GO:PFM GO:0050568|"GO:protein-glutamine glutaminase activity"|PF03975|IPR005659| RP:SCP:NREP 1 RP:SCP:REP 9->148|2f9zC1|4e-33|39.6|139/152|d.194.1.3| OP:NHOMO 295 OP:NHOMOORG 269 OP:PATTERN -----------------------11-11-1-----1--1111111-11-1212-1-1-11-------- 1-----------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------111---------------1111-1---1111111------11------------------------------------------------------------------------------------------11111111111111111111---111---1121111111211111111-----1111-----11-11-------1------------------------111211111111--1---1-111111---------111----1----------------------------------1111111111111111111111112121111111--111211111--211111111121-------11--1313-1-11--11--1-3131322-11111-1111-------------------1------1--1-1-----11111---111-12---11-----1---------------------------------------------------------------------------------------------------------2-1---------------------------1111-----------11---------1----11111---111111111111------1122111111111111----------------------------1--1111111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 69.6 SQ:SECSTR #############TcEEEEETTcEEEEEEEcccEEEEEEETTTTEEEEEEEcccccccccccGG#GcHHHHHHHHHHHHHTTTccGGGcEEEEEEccccccccccHHHHHHHHHHHHHHHTTccEEEEEEcccccEEEEE######################################### DISOP:02AL 1-5, 57-62, 158-175| PSIPRED cccccccEEEEEcccEEEEccccEEEEEEcccEEEEEEEcccccEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHcccHHHEEEEEEEcHHHHcccccHHHHHHHHHHHHHHHcccEEEEEEcccccccEEEEEccccEEEEEEcccccHHHHHHHHHHHHHHccccccccccc //