[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : cheR
DDBJ      :cheR         chemotaxis methyltransferase
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  489/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.58.1c.66.1
:302 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->291 1bc5A PDBj 3e-45 40.2 %
:RPS:PDB   18->292 1af7A PDBj 2e-37 36.8 %
:RPS:SCOP  18->93 1af7A1  a.58.1.1 * 7e-15 30.3 %
:RPS:SCOP  94->292 1af7A2  c.66.1.8 * 9e-60 40.5 %
:HMM:SCOP  13->93 1af7A1 a.58.1.1 * 1.8e-15 32.1 %
:HMM:SCOP  94->281 1af7A2 c.66.1.8 * 2.8e-52 35.6 %
:RPS:PFM   28->77 PF03705 * CheR_N 1e-05 38.0 %
:RPS:PFM   94->277 PF01739 * CheR 2e-50 48.6 %
:HMM:PFM   94->292 PF01739 * CheR 1.4e-75 45.1 195/196  
:HMM:PFM   26->80 PF03705 * CheR_N 1.1e-16 36.4 55/57  
:BLT:SWISS 35->302 CHER_RHIEC e-133 83.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86332.1 GT:GENE cheR GT:PRODUCT chemotaxis methyltransferase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 508701..509609 GB:FROM 508701 GB:TO 509609 GB:DIRECTION + GB:GENE cheR GB:PRODUCT chemotaxis methyltransferase GB:PROTEIN_ID AAK86332.1 GB:DB_XREF GI:15155452 GB:GENE:GENE cheR LENGTH 302 SQ:AASEQ MAALNLSDQRQSPDDVLASGEYPLTRRDLSEIAAMIYADAGIYLNDTKASLVYSRLSKHIRNLGLSGFREYCALVSSSEGAQPRREMLSHLTTNFTRFFRENHHFEHLRDEVLPGLIARAKSGGRVRIWSAACSDGQEPYSIALTVLAMFPNAADYDFKILATDIDPKILAQARAGVYDDNALETVSPAMRKQWFTEVDAGGRRKFRIDDKVKRLITFNELNLMTQWPFKGNFDVIFCRNVVIYFDEPTQVRIWSRFAGLLPEGGHLYIGHSERVSGDAKNVFDNTGITTYRFIGHASGRKA GT:EXON 1|1-302:0| BL:SWS:NREP 1 BL:SWS:REP 35->302|CHER_RHIEC|e-133|83.2|268/268| BL:PDB:NREP 1 BL:PDB:REP 32->291|1bc5A|3e-45|40.2|251/269| RP:PDB:NREP 1 RP:PDB:REP 18->292|1af7A|2e-37|36.8|266/274| RP:PFM:NREP 2 RP:PFM:REP 28->77|PF03705|1e-05|38.0|50/57|CheR_N| RP:PFM:REP 94->277|PF01739|2e-50|48.6|181/195|CheR| HM:PFM:NREP 2 HM:PFM:REP 94->292|PF01739|1.4e-75|45.1|195/196|CheR| HM:PFM:REP 26->80|PF03705|1.1e-16|36.4|55/57|CheR_N| GO:PFM:NREP 2 GO:PFM GO:0008757|"GO:S-adenosylmethionine-dependent methyltransferase activity"|PF03705|IPR000780| GO:PFM GO:0008757|"GO:S-adenosylmethionine-dependent methyltransferase activity"|PF01739|IPR000780| RP:SCP:NREP 2 RP:SCP:REP 18->93|1af7A1|7e-15|30.3|76/81|a.58.1.1| RP:SCP:REP 94->292|1af7A2|9e-60|40.5|190/193|c.66.1.8| HM:SCP:REP 13->93|1af7A1|1.8e-15|32.1|81/81|a.58.1.1|1/1|Chemotaxis receptor methyltransferase CheR, N-terminal domain| HM:SCP:REP 94->281|1af7A2|2.8e-52|35.6|180/193|c.66.1.8|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1067 OP:NHOMOORG 518 OP:PATTERN -----------------------11111-111---1--1111133-13-2422-1-1-11-------- 1221-----------11----1---1--------------2---2---1-------------1-1---------------1----2-------------1-1-2-52423-----------------111---21-22222---11112122--------------32231------------2-------211222222221222222111121222111111111111113------------------------------------------------------------------------------------------31123111111111111221---115--11131114213212111221--1124334-----3135631144225----------1-224224472---1113322223531-211-2-444425---------22211734------------------------------1-211211-12223324222344352223132243422--11231422221421123121242-------1112232822215317633219AA7849257767862-1-11-1111-1-1-------21-5---32-224111142222221122212311133---2241------11111111111111111-1111111111111111111---111111111111111111111111-1111--111111111111---1---------22512-------------------------1444444335434334444-----1---1111233333111331244444333------621122222222222211--------------------------1-11211111-3- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 273 STR:RPRED 90.4 SQ:SECSTR #################ccccccccHHHHHHHHHHHHHHHcccccGGGHHHHHHHHHHHHHHHTcccHHHHHHHHHHcTTcTHHHHHHHHHccccccTTTTTTHHHHHHHHHHH#HHHHHHccccEEEEEcccTTTHHHHHHHHHHHHHHccHcTTcEEEEEEEccHHHHHHHHHTEEEGGGGTTccHHHHHHHEEEccTTcccEEEEcHHHHTTEEEEEccTTccccccccEEEEEEcccGGGccHHHHHHHHHHHGGGEEEEEEEEEcTTcccTTTcTT#EEEEETTEEE########## DISOP:02AL 1-15, 298-302| PSIPRED cccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHccccHHHHHcccHHHHHHHccccccccccEEEEcHHHHHccccHHccccccccccccccEEEEccHHHHccHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHcccEEEEEcccccccc //