[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : cheY.1
DDBJ      :cheY         chemotaxis receiver protein
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  837/915 : Eukaryota  41/199 : Viruses  0/175   --->[See Alignment]
c.23.1
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->119 3dgeC PDBj 4e-22 38.7 %
:RPS:PDB   1->119 3dgeC PDBj 3e-24 38.7 %
:RPS:SCOP  2->119 1a0oA  c.23.1.1 * 5e-30 34.7 %
:HMM:SCOP  2->121 1s8nA_ c.23.1.1 * 1.5e-34 39.3 %
:RPS:PFM   5->116 PF00072 * Response_reg 2e-18 44.5 %
:HMM:PFM   5->117 PF00072 * Response_reg 2e-29 39.6 111/112  
:BLT:SWISS 2->119 YCF27_PORAE 8e-20 37.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86330.1 GT:GENE cheY.1 GT:PRODUCT chemotaxis receiver protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 506032..506397 GB:FROM 506032 GB:TO 506397 GB:DIRECTION + GB:GENE cheY GB:PRODUCT chemotaxis receiver protein GB:PROTEIN_ID AAK86330.1 GB:DB_XREF GI:15155450 GB:GENE:GENE cheY LENGTH 121 SQ:AASEQ MKKKVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGIEGLEVLEQSNPDVIVTDINMPRLDGFGFIEGVRRNEKYRAIPILVLTTESDAEKKNRARQAGATGWIVKPFDPAKLIDAIERVTA GT:EXON 1|1-121:0| BL:SWS:NREP 1 BL:SWS:REP 2->119|YCF27_PORAE|8e-20|37.4|115/240| BL:PDB:NREP 1 BL:PDB:REP 1->119|3dgeC|4e-22|38.7|119/122| RP:PDB:NREP 1 RP:PDB:REP 1->119|3dgeC|3e-24|38.7|119/122| RP:PFM:NREP 1 RP:PFM:REP 5->116|PF00072|2e-18|44.5|110/111|Response_reg| HM:PFM:NREP 1 HM:PFM:REP 5->117|PF00072|2e-29|39.6|111/112|Response_reg| GO:PFM:NREP 3 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| RP:SCP:NREP 1 RP:SCP:REP 2->119|1a0oA|5e-30|34.7|118/128|c.23.1.1| HM:SCP:REP 2->121|1s8nA_|1.5e-34|39.3|117/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 10046 OP:NHOMOORG 905 OP:PATTERN -----------------------5122--113---3--2222276-5N28847-2-2111-------- BRN4I14344432477666-6B3399666666A8888A89D85BF8565873A68468--89D7I48QMG4222265513E56-3776A9XO-C-----95J4ECR6X6G--------------2321352351D5bZZaXA86j6uYosbbAJKEE454676QVIB***L444444444444C8B334636BFOOPOPMQPGSOQNNNCGEDABPURDBBM9ABA99A9Aai6334444344333446342473335543213333355423453131AA935456666666666666633333433333435225532227FSCIbGGGHHHJKGHJMHH8AD8LFL53FDIB6PPQKCB88A7A8BE338NLHRNNJ44433A9OOQ99AHIDCI5555555555A-FEJDHDEM9BA1CCCFFFGHJJFHB6B9C896DCED9G95555555566543VHK11111111112224222232242241-11-736848876BLNMOPIKCCBCHHUXEEEF8EMLNFJOI12FHGSDG99JAJKF8CFJGIHII711-----99DGSjFogVDBYM9paIIP4mdmffZfIQVWfannKQE665-444343333333333DK85955KG8RLNB9ECDCAEEFIDCGFFFGHDEEMN--699CG------A899799A87AAAAA9A-8AB9BAA9A98A9AA9AA9BCB89897A89BABAA9AABABBB9886999A5-A9ABBBA99BBA---A2222222238Ak7K11111113333---2A988A68585BFTRTSMaVbOKLKLKRPU11-1-21-1AEDGOEFFFFHHENNPONIMIIHHJ777711o4FF89994333333331--------------------------6B466344443Q3 ----11--------5-1-1----1-----------------------1-----------1------------------------------21113-1111211-----21------------------------------------------------3----2---------5--211-4221-52161123-7---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 100.0 SQ:SECSTR cccEEEEEcccHHHHHHHHHHHHTTTcEEEEEccHHHHHHTTTTcccccEEEccccccccHHHHHHHHHccHHHHTccEEEEEccccHHHHHHHHTTTccEEEEccccHHHHHHHHHHHHc DISOP:02AL 120-122| PSIPRED cccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHc //