[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : cheY.2
DDBJ      :cheY         chemotaxis receiver protein
Swiss-Prot:CHEY_RHIEC   RecName: Full=Probable chemotaxis protein cheY;

Homologs  Archaea  16/68 : Bacteria  683/915 : Eukaryota  23/199 : Viruses  0/175   --->[See Alignment]
c.23.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->129 1p6qA PDBj 6e-62 89.9 %
:RPS:PDB   5->125 2cheA PDBj 4e-23 33.1 %
:RPS:SCOP  1->125 1p6qA  c.23.1.1 * 8e-25 90.4 %
:HMM:SCOP  4->126 1s8nA_ c.23.1.1 * 2.7e-33 35.8 %
:RPS:PFM   9->121 PF00072 * Response_reg 9e-17 40.9 %
:HMM:PFM   9->121 PF00072 * Response_reg 4.9e-28 36.0 111/112  
:BLT:SWISS 1->129 CHEY_RHIEC 3e-63 90.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86334.1 GT:GENE cheY.2 GT:PRODUCT chemotaxis receiver protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 510661..511050 GB:FROM 510661 GB:TO 511050 GB:DIRECTION + GB:GENE cheY GB:PRODUCT chemotaxis receiver protein GB:PROTEIN_ID AAK86334.1 GB:DB_XREF GI:15155454 GB:GENE:GENE cheY LENGTH 129 SQ:AASEQ MSLAEKIKVLIVDDQVTSRLLLSDALTQLGFKQITSAGDGEQGLKIMEQQPHHLVISDFNMPKMDGLGFLHAVRANPTTKKAAFIILTAQGDRALVQKAAQLGANNVLAKPFTIDKMRAAIEAVFGSLK GT:EXON 1|1-129:0| SW:ID CHEY_RHIEC SW:DE RecName: Full=Probable chemotaxis protein cheY; SW:GN Name=cheY; OrderedLocusNames=RHE_CH00643; ORFNames=RHE_CH00644; SW:KW Chemotaxis; Complete proteome; Cytoplasm; Phosphoprotein;Two-component regulatory system. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->129|CHEY_RHIEC|3e-63|90.7|129/129| GO:SWS:NREP 3 GO:SWS GO:0006935|"GO:chemotaxis"|Chemotaxis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|Two-component regulatory system| BL:PDB:NREP 1 BL:PDB:REP 1->129|1p6qA|6e-62|89.9|129/129| RP:PDB:NREP 1 RP:PDB:REP 5->125|2cheA|4e-23|33.1|121/128| RP:PFM:NREP 1 RP:PFM:REP 9->121|PF00072|9e-17|40.9|110/111|Response_reg| HM:PFM:NREP 1 HM:PFM:REP 9->121|PF00072|4.9e-28|36.0|111/112|Response_reg| GO:PFM:NREP 3 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| RP:SCP:NREP 1 RP:SCP:REP 1->125|1p6qA|8e-25|90.4|125/129|c.23.1.1| HM:SCP:REP 4->126|1s8nA_|2.7e-33|35.8|120/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 3394 OP:NHOMOORG 722 OP:PATTERN -----------------------11--1-1-----1-------22--C-2434-1-1-11-------- 48522--1------11111-14111111111122221212442442--232212211111-1516-23231---------1-1-13235589-3-----133-3392B191-------------11--21-11-71HBCB8212E2RADIDD6AC56323234FA97VTb71213111213211421111-2556666655556655663944765677785265222223EG211111111111111-----1----1-----11--11---11--1-11111-11--11111111111------------1---------17D44B444454546373554333465--5339487AA753355666421-7B3AAAA-----34A8C43455646----------2-64A76758--3-86678878887921525335AAA8453111111113333-B98------------------------------131-1122137556555333334453334245777667--335924457476233444977B4-------23637A7LJB54D95RFAAC2OIMEGKLA6ECCELJD7431221121112222222127731211C9255745794857788745667587989A--13774------55445343333333333-3333333333333333333233332224334444434434343433233334-634454334453---1--------134C17--------111---111111-21223489987CCF978864798---------9656B89999646988A998997883333--D1443344211222121---------------------------2-22333323-B- ----111-------2-1-----------1-------1--------------1-111-------------------------------1----1---2-1------1---1------------------------------------------------2-------------------1------4--3---2-2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 100.0 SQ:SECSTR ccTcTTccEEEEcccHHHHHHHHHHHHHHTcccEEEEccHHHHHHHHTTccccEEEEEcccccccHHHHHHHHHHcTTTTTccEEEEEccccHHHHHHHHHTTccEEEEccccHHHHHHHHHHHHccTc DISOP:02AL 1-5| PSIPRED cccccccEEEEEEccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHcc //