[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : coaE
DDBJ      :coaE         dephospho-CoA kinase
Swiss-Prot:COAE_AGRT5   RecName: Full=Dephospho-CoA kinase;         EC=2.7.1.24;AltName: Full=Dephosphocoenzyme A kinase;

Homologs  Archaea  0/68 : Bacteria  764/915 : Eukaryota  126/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:193 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->191 2if2A PDBj 2e-23 38.7 %
:RPS:PDB   3->191 1a7jA PDBj 1e-21 15.3 %
:RPS:SCOP  2->191 1uf9A  c.37.1.1 * 2e-30 34.9 %
:HMM:SCOP  1->191 1dekA_ c.37.1.1 * 2.9e-36 36.4 %
:RPS:PFM   3->178 PF01121 * CoaE 1e-26 44.3 %
:HMM:PFM   2->175 PF01121 * CoaE 2.1e-41 35.5 172/180  
:BLT:SWISS 1->193 COAE_AGRT5 e-106 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85829.2 GT:GENE coaE GT:PRODUCT dephospho-CoA kinase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 2508..3089 GB:FROM 2508 GB:TO 3089 GB:DIRECTION + GB:GENE coaE GB:PRODUCT dephospho-CoA kinase GB:PROTEIN_ID AAK85829.2 GB:DB_XREF GI:159139458 GB:GENE:GENE coaE LENGTH 193 SQ:AASEQ MIVIGLTGSIGMGKTTTAKLFAEEGVPVLDSDEVVHGLYRAEAVPLIDAAFPGTTISGMVDRQKLGDVLRKNPANFNRLEEIVHPLVRNRQEAFLAKARIDDRAFALLDIPLLFETGAEGRVDKVVVVSCAPEIQRERVLSRPGMTEEKFEMILARQMPDAEKRQRADFVVDSGNGVEAARDQVKEILQKLGA GT:EXON 1|1-193:0| SW:ID COAE_AGRT5 SW:DE RecName: Full=Dephospho-CoA kinase; EC=2.7.1.24;AltName: Full=Dephosphocoenzyme A kinase; SW:GN Name=coaE; OrderedLocusNames=Atu0004; ORFNames=AGR_C_5; SW:KW ATP-binding; Coenzyme A biosynthesis; Complete proteome; Cytoplasm;Kinase; Nucleotide-binding; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->193|COAE_AGRT5|e-106|100.0|193/194| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0015937|"GO:coenzyme A biosynthetic process"|Coenzyme A biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 4->191|2if2A|2e-23|38.7|181/190| RP:PDB:NREP 1 RP:PDB:REP 3->191|1a7jA|1e-21|15.3|189/279| RP:PFM:NREP 1 RP:PFM:REP 3->178|PF01121|1e-26|44.3|174/179|CoaE| HM:PFM:NREP 1 HM:PFM:REP 2->175|PF01121|2.1e-41|35.5|172/180|CoaE| RP:SCP:NREP 1 RP:SCP:REP 2->191|1uf9A|2e-30|34.9|186/191|c.37.1.1| HM:SCP:REP 1->191|1dekA_|2.9e-36|36.4|184/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 939 OP:NHOMOORG 890 OP:PATTERN -------------------------------------------------------------------- 111--11-1111111------1111------1111111--1111-1-1-11111-1-1----111-111111111111---1111111---111-----111111-1-1-11111111111111111--111111-1111111-11111111111111111-11111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1111111-1--111-111---1-1111111111111111111-11111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111--11111111111111111-111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-111-11111111111111-111111111111111111111111111111-1--1-1-1111111111111111111111-111-1------111111-1111111111-1111111111111111111111111111111111111-11111111111111-111111111111-1-111111111111111111111111111---111111111111111111111111111111--------1-11-1111111--1--1-1-----11111-1-111111----------1--------------------------11--11--11-1 -----11-21--111----------------------1-1-11-------------------111111-111111111-111111111-111-1111-11111111-16-111111-1-122113213-231-111-2-232232-21112--221212111121111122111-12216111221113-2111----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 191 STR:RPRED 99.0 SQ:SECSTR cEEEEEEccccTHHHHHHHHHHHHTccEGGGGccccHHHHHHHHHHHHTcTTccTTcGGccHHHHHHHHHHHHHHcccEEccccccccccTTcccccEEccccccEEEEEccTTcccccccccEEEEEEEcHHHHHHHHHHHcccccccHHHHHHHHHHHHHHGGTccEEEEEEEccccccGGGccccccG## PSIPRED cEEEEEEccccccHHHHHHHHHHcccEEEEHHHHHHHHHcccHHHHHHHHcccccccccccHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHHHHHcccccEEEEEEHHHHHccHHHHccEEEEEEccHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHccEEEEccccHHHHHHHHHHHHHHHcc //