[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : cobL
DDBJ      :cobL         precorrin-6y methyltransferase
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  309/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.66.1c.90.1
:419 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->151 2bb3B PDBj 9e-06 29.6 %
:BLT:PDB   247->417 3hm2G PDBj 3e-31 46.7 %
:RPS:PDB   16->235 2e0kA PDBj 1e-23 18.2 %
:RPS:PDB   236->417 3e05B PDBj 3e-17 31.9 %
:RPS:SCOP  23->223 2bb3A1  c.90.1.1 * 6e-46 29.4 %
:RPS:SCOP  238->411 1f38A  c.66.1.22 * 6e-32 26.7 %
:HMM:SCOP  20->222 2bb3A1 c.90.1.1 * 9.5e-42 34.7 %
:HMM:SCOP  221->413 1i9gA_ c.66.1.13 * 3.9e-29 25.7 %
:RPS:PFM   21->134 PF00590 * TP_methylase 6e-04 33.3 %
:RPS:PFM   245->364 PF01135 * PCMT 4e-08 33.9 %
:HMM:PFM   21->201 PF00590 * TP_methylase 6.2e-33 31.7 180/210  
:HMM:PFM   249->366 PF01135 * PCMT 1.6e-08 30.2 116/210  
:BLT:SWISS 19->417 COBL_PSEDE e-133 59.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88511.2 GT:GENE cobL GT:PRODUCT precorrin-6y methyltransferase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2799463..2800722) GB:FROM 2799463 GB:TO 2800722 GB:DIRECTION - GB:GENE cobL GB:PRODUCT precorrin-6y methyltransferase GB:PROTEIN_ID AAK88511.2 GB:DB_XREF GI:159140636 GB:GENE:GENE cobL LENGTH 419 SQ:AASEQ MTSEYSGTAKASTEKNEKPWLSIVGIGEDGLQGLGENARQAIEAAEVVFGGKRHLELAAGAIRGEARAWPVPFDVDMNDVLALRGRLVCVLASGDPFFYGAGVTLLRRIPAEETACYPSPSAFSLAASRLGWALQSAECVSLHGRSIDLLRPHLHHGARIIALTSDERDPALIARLLSDAGFGRSEFILLEALGGDREKRRQIRAADFGFEDTDPLNVVAIEVVADEGARLLPFAHGLDDGLFEHDGQITKREIRAVTLSSLASRRGELLWDIGAGSGSIGIEWMLSHPSLRAIAIEQHPERAERIARNADAFGVPGLEVMIGTAPAAFEGLSSPDAIFIGGGGSETGVLEAAMDALKPGGRLVANAVTLEMEAVLLAAHAKFGGSMIRLEVSRAAAVGSMSGWRPAMPVTQWSWVKPW GT:EXON 1|1-419:0| BL:SWS:NREP 1 BL:SWS:REP 19->417|COBL_PSEDE|e-133|59.4|399/413| BL:PDB:NREP 2 BL:PDB:REP 36->151|2bb3B|9e-06|29.6|115/188| BL:PDB:REP 247->417|3hm2G|3e-31|46.7|167/169| RP:PDB:NREP 2 RP:PDB:REP 16->235|2e0kA|1e-23|18.2|214/241| RP:PDB:REP 236->417|3e05B|3e-17|31.9|182/192| RP:PFM:NREP 2 RP:PFM:REP 21->134|PF00590|6e-04|33.3|114/206|TP_methylase| RP:PFM:REP 245->364|PF01135|4e-08|33.9|118/205|PCMT| HM:PFM:NREP 2 HM:PFM:REP 21->201|PF00590|6.2e-33|31.7|180/210|TP_methylase| HM:PFM:REP 249->366|PF01135|1.6e-08|30.2|116/210|PCMT| GO:PFM:NREP 4 GO:PFM GO:0008152|"GO:metabolic process"|PF00590|IPR000878| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF00590|IPR000878| GO:PFM GO:0004719|"GO:protein-L-isoaspartate (D-aspartate) O-methyltransferase activity"|PF01135|IPR000682| GO:PFM GO:0006464|"GO:protein modification process"|PF01135|IPR000682| RP:SCP:NREP 2 RP:SCP:REP 23->223|2bb3A1|6e-46|29.4|187/191|c.90.1.1| RP:SCP:REP 238->411|1f38A|6e-32|26.7|172/186|c.66.1.22| HM:SCP:REP 20->222|2bb3A1|9.5e-42|34.7|193/0|c.90.1.1|1/1|Tetrapyrrole methylase| HM:SCP:REP 221->413|1i9gA_|3.9e-29|25.7|191/0|c.66.1.13|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 382 OP:NHOMOORG 331 OP:PATTERN -------111111111--1-1-1-----------1--------------111---------1-1--11 ----1-11111-1-11111-11--1111111111111111-111----------------1-111121111----------11-----11-1-111---------1-------------------11-1-----1111111-----2222221222211111212222222111111111111---11----1-------------------------111----1111111----------------------------------11---------------------------------------------1----------121-----------11------11----111-11211--1122-----1------------11111---1111111111111111-21111111-1--11111111111111---111111111111111111----11-1-------------------------------1--------111111111111111111111111----------21--111-1---1-----------------11-11-1-111-1111-111111111-----1-1-----------------------------1-------------------------1------1-------2---2--------------------------------222--22-2222222222222222----------2------------------------1-1-1---------------------------1111111111111-111---------------------1------------------1---1111---------------------------------------21-------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 405 STR:RPRED 96.7 SQ:SECSTR ##############ccccccEEEEEcccccGGGccHHHHHHHHHccEEEEEEEEcTTccEEcHHHHHHTTTTccGGGEEHHHHTTccEEEEEcccTTcccTTHHHHHHHHHTcEEEEccccHHHHHHHHTTcccccTTEEEEccccHHHHHHHHHHcccEEEEcGGGGTTTHHHHHHHHccccTccEEEEEcTTcTTcEEEcEcGGGGccccccccEEEEEcGGGGccTHTccccccccGGGGccccccHHHHHHHHHHHHTTTTTTcEEEEETcTTcTTHHHHHHTTcEEEEEEccHHHHHHHHHHHHHTTcccEEEEccTTTTccTTccEEEEEEcccccTTccccHHHHHHHHEEEEEEEEEEEcTTccHHHHHHHHHccccEEEEEccEEccccccccccEEcccEEEEEEEccE DISOP:02AL 1-5,8-14| PSIPRED ccccccccEEccccccccccEEEEEEccccHHHccHHHHHHHHHccEEEEcHHHHHHHHHHccccEEEEccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccccEEEEEEEccccccEEEEEcHHHccccccccEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccEEEEEccHHHHccccccccEEEEcccccHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHcccEEEEEEEEEEEEEcccccccccccEEEEEEEEcc //