[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : cobS.1
DDBJ      :cobS         cobalamin biosynthesis protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  235/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:261 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   13->257 PF02654 * CobS 1e-26 40.2 %
:HMM:PFM   13->257 PF02654 * CobS 2.9e-41 35.3 232/235  
:BLT:SWISS 6->260 COBS_AGRVS 2e-49 43.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87656.1 GT:GENE cobS.1 GT:PRODUCT cobalamin biosynthesis protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1870336..1871121 GB:FROM 1870336 GB:TO 1871121 GB:DIRECTION + GB:GENE cobS GB:PRODUCT cobalamin biosynthesis protein GB:PROTEIN_ID AAK87656.1 GB:DB_XREF GI:15157009 GB:GENE:GENE cobS LENGTH 261 SQ:AASEQ MKAGDFITDVMHSVAFLSRLPVPSRFFGEGDGASMRRTARAFPAAGLLIALPAAFLVVIFATFDASPQLTGWLAIGLTALITGALHEDGLADMADGFGSGKDKARMLEIMKDSRIGSYGTIAMVLSFALRATALASLIETLPGKTAAACLIATLVMSRALMVWHWQALPAAKTSGIAAGAGQPGESDRNIALVTGLLVFILFTLHALPILSIALVMAAAILATVLFGRLCDRKIGGHTGDTIGACQQITEIVTLVALALAA GT:EXON 1|1-261:0| BL:SWS:NREP 1 BL:SWS:REP 6->260|COBS_AGRVS|2e-49|43.5|253/259| TM:NTM 5 TM:REGION 42->64| TM:REGION 66->88| TM:REGION 117->139| TM:REGION 142->163| TM:REGION 198->220| SEG 41->56|afpaagllialpaafl| RP:PFM:NREP 1 RP:PFM:REP 13->257|PF02654|1e-26|40.2|234/237|CobS| HM:PFM:NREP 1 HM:PFM:REP 13->257|PF02654|2.9e-41|35.3|232/235|CobS| GO:PFM:NREP 2 GO:PFM GO:0008818|"GO:cobalamin 5'-phosphate synthase activity"|PF02654|IPR003805| GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF02654|IPR003805| OP:NHOMO 241 OP:NHOMOORG 236 OP:PATTERN -------------------------------------------------------------------- ----1------------11-1-----11111----------------------------------------------------------------------11--1-1-----------------11111--11111------2--------------------11-111----------------------------------------1-------1------1--11111--------------------------------------------------------------------------------1----------111-1111111-1-1-111----1----------11---1-1111--1-1-----------1-1-----2-22111111111111-11-1111--1--1111111111111-11--11-1--11-11111111-11-1--1----------------------------------------1111111----1111-----1111-1----11--1------1--111-111------------1-1---11-----------------1--------------------------------------1--1--1--1-----1-111-11---2--------------1------1111111111-111111111111111111------1----11111111111111-1111111----------------------------11-1---------------11111------1------------------------------11111111111------------------11------------1---------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 173-182| PSIPRED ccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHc //