[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : coxA
DDBJ      :coxA         cytochrome-c oxidase chain I
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  605/915 : Eukaryota  61/199 : Viruses  0/175   --->[See Alignment]
f.24.1
:569 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->567 1m56A PDBj 0.0 59.4 %
:RPS:PDB   35->563 1ar1A PDBj 3e-85 34.1 %
:RPS:SCOP  35->563 1ar1A  f.24.1.1 * e-137 59.6 %
:HMM:SCOP  35->571 1ocrA_ f.24.1.1 * 1.6e-215 61.1 %
:RPS:PFM   102->499 PF00115 * COX1 e-142 71.3 %
:HMM:PFM   46->515 PF00115 * COX1 6.8e-171 53.4 442/447  
:BLT:SWISS 40->568 COX1_RHILE 0.0 76.0 %
:PROS 292->346|PS00077|COX1_CUB
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86577.2 GT:GENE coxA GT:PRODUCT cytochrome-c oxidase chain I GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 763517..765226 GB:FROM 763517 GB:TO 765226 GB:DIRECTION + GB:GENE coxA GB:PRODUCT cytochrome-c oxidase chain I GB:PROTEIN_ID AAK86577.2 GB:DB_XREF GI:159139770 GB:GENE:GENE coxA LENGTH 569 SQ:AASEQ MAGPSAHDDHHSHGQSAHDAHAHDDHSHDHSHKPGFFARWFLSTNHKDIGTLYLIFAIMAGIIGGGLSVVMRMELQEPGIQIFHGLASMVYGFEGDAAIDGGKHMFNVFTTAHALIMIFFMVMPAMIGGFANWMIPIMIGAPDMAFPRLNNISFWLIVPAFILLLLSLFVEGPAGAYGVGGGWTMYPPLSTSGMPGPAVDLAIFSLHVAGASSILGAINFITTILNMRAPGMTLHKMPLFAWSVLVTAFLLLLSLPVLAGGITMLLTDRNFGTAFFSPEGGGDPILYQHLFWFFGHPEVYILILPGFGIISHIVSTFSKKPVFGYLGMAYAMVAIGAVGFIVWAHHMYTVGLSLEAQRYFVFATMVIAVPTGIKIFSWIATMWGGSLTFSTPMVWAIGFIFLFTVGGVTGVQLANAGLDRSLHDTYYVVAHFHYVLSLGAVFAIFAGWYYWFPKITGYMYNEFIGKLHFWVMFIGVNLIFFPQHFLGLAGMPRRYIDYPDAYAGWNMVSSYGSYISAVAVGIFLFGVWEAFAKKRIAGNNPWGEGATTLEWQLSSPPPYHQWEQLPRIR GT:EXON 1|1-569:0| BL:SWS:NREP 1 BL:SWS:REP 40->568|COX1_RHILE|0.0|76.0|512/538| PROS 292->346|PS00077|COX1_CUB|PDOC00074| TM:NTM 12 TM:REGION 60->82| TM:REGION 117->139| TM:REGION 150->172| TM:REGION 200->222| TM:REGION 241->263| TM:REGION 296->318| TM:REGION 323->345| TM:REGION 361->383| TM:REGION 393->415| TM:REGION 426->448| TM:REGION 464->486| TM:REGION 511->532| SEG 5->32|sahddhhshgqsahdahahddhshdhsh| SEG 55->66|ifaimagiiggg| SEG 172->182|gpagaygvggg| SEG 244->258|vlvtafllllslpvl| BL:PDB:NREP 1 BL:PDB:REP 35->567|1m56A|0.0|59.4|532/547| RP:PDB:NREP 1 RP:PDB:REP 35->563|1ar1A|3e-85|34.1|525/529| RP:PFM:NREP 1 RP:PFM:REP 102->499|PF00115|e-142|71.3|390/423|COX1| HM:PFM:NREP 1 HM:PFM:REP 46->515|PF00115|6.8e-171|53.4|442/447|COX1| GO:PFM:NREP 5 GO:PFM GO:0005506|"GO:iron ion binding"|PF00115|IPR000883| GO:PFM GO:0009055|"GO:electron carrier activity"|PF00115|IPR000883| GO:PFM GO:0009060|"GO:aerobic respiration"|PF00115|IPR000883| GO:PFM GO:0016021|"GO:integral to membrane"|PF00115|IPR000883| GO:PFM GO:0020037|"GO:heme binding"|PF00115|IPR000883| RP:SCP:NREP 1 RP:SCP:REP 35->563|1ar1A|e-137|59.6|527/529|f.24.1.1| HM:SCP:REP 35->571|1ocrA_|1.6e-215|61.1|512/514|f.24.1.1|1/1|Cytochrome c oxidase subunit I-like| OP:NHOMO 1259 OP:NHOMOORG 692 OP:PATTERN 22----6333333336-12-2---42241122-----------------------------1----11 1242111111111131111-151121111112322325342342111111111111111122213222223------------1-----------------121111121--------------11----------22222---12132211111112122222212534211111111211212122---23222222222222222223222222213242221111114221111111111111111111--------------------------------------------------------------------------------------------------2---------------------1-21223111111254364112232112212222221355436344421322254335454211112133333121111111112331212-111111111111111111111111-111111112-1443543333432333444766664445646551144422322212151321121121-------1243211-1---11-1-111-1-1-1111-222222----------------------1----2211131111221112221212222212321211-41-111111111111111111111111-1111111111111111111111111111111111111111111111----111111111111111112111111121122111---------------1111111---2122222322222222111-11111111----2-----221113322222222111111--111111----------------------------------------------32- -2------1-----1--1---------112-12111-------111-1------111-----5-311---1-----4----------------1---11-1----2------11111-----1-1--1-14--11-----1--21--------1-1--1----2-112--p-15-1-1-------1--4--1--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 535 STR:RPRED 94.0 SQ:SECSTR ################################ccccTTTTTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccGGGTTcccccccccccccHHHHHHHHHHHHHHHHHHTHHHHHTTTHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHHHHcEETTTEEccccTTTTcTTTHGGGccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccTTccGGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccTTcGGGTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccTTHHHHHHHHHHHHHHTTccGGGGcGGGTccHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHTTcHHHHHHHHHHHTTTHHHHHHHHHHHHHHHHHcEEccHHHHHHHHHHHHHHHHHHHcHHHHHHHTTcccccccccGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEccccccccTcccGGGTccccccccccccccc## DISOP:02AL 1-26| PSIPRED ccccccccccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccHHHHHHccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccEEccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccEEEEccHHHHHHHHHHHHHHHHHccHHHccccccEEEccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHccccccccccHHHccccc //