[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : coxB
DDBJ      :coxB         cytochrome c oxidase subunit II
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  410/915 : Eukaryota  65/199 : Viruses  0/175   --->[See Alignment]
b.6.1f.17.2
:287 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->260 1ar1B PDBj 4e-53 47.3 %
:RPS:PDB   10->253 3dtuB PDBj 7e-46 40.4 %
:RPS:SCOP  14->102 1ar1B2  f.17.2.1 * 3e-19 37.1 %
:RPS:SCOP  111->263 1ar1B1  b.6.1.2 * 1e-34 49.3 %
:HMM:SCOP  3->109 1ar1B2 f.17.2.1 * 1.2e-25 31.8 %
:HMM:SCOP  110->264 1m56B1 b.6.1.2 * 1.8e-48 50.7 %
:RPS:PFM   18->101 PF02790 * COX2_TM 1e-09 32.1 %
:RPS:PFM   114->244 PF00116 * COX2 4e-36 56.3 %
:HMM:PFM   114->245 PF00116 * COX2 6.6e-43 52.5 120/120  
:HMM:PFM   15->101 PF02790 * COX2_TM 4.9e-23 24.4 82/84  
:BLT:SWISS 14->273 COX2_PARDE 7e-53 47.2 %
:PROS 190->238|PS00078|COX2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86576.2 GT:GENE coxB GT:PRODUCT cytochrome c oxidase subunit II GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 762636..763499 GB:FROM 762636 GB:TO 763499 GB:DIRECTION + GB:GENE coxB GB:PRODUCT cytochrome c oxidase subunit II GB:PROTEIN_ID AAK86576.2 GB:DB_XREF GI:159139769 GB:GENE:GENE coxB LENGTH 287 SQ:AASEQ MTCLLTAVGAHADQPVHWQMGMQEAATPIMHEIRWFEQYTLWFIVPVTLFVLALLIIVAVKFHAAKNPVASKTSHNTAIEVVWTLAPVLILLFLAFPSFNLLNAQLTQPENPDLTLKATATQWLWSYEYKAAEGAEPLSFDSYLLKDQDRAAAGKEDKARYPRLLAVDNEMVVPVGKTVRLLVTAAPTDVIHAFAMPAFGVKIDAVPGRLNETWFKPEKEGLYYGQCSELCGKDHAFMPIAIRVVSEQQYNTWHAAAASDLNGANRALMASVDGAPRTVDVAANETN GT:EXON 1|1-287:0| BL:SWS:NREP 1 BL:SWS:REP 14->273|COX2_PARDE|7e-53|47.2|250/298| PROS 190->238|PS00078|COX2|PDOC00075| TM:NTM 2 TM:REGION 40->62| TM:REGION 77->99| SEG 51->60|vlalliivav| BL:PDB:NREP 1 BL:PDB:REP 14->260|1ar1B|4e-53|47.3|237/252| RP:PDB:NREP 1 RP:PDB:REP 10->253|3dtuB|7e-46|40.4|230/259| RP:PFM:NREP 2 RP:PFM:REP 18->101|PF02790|1e-09|32.1|78/82|COX2_TM| RP:PFM:REP 114->244|PF00116|4e-36|56.3|119/119|COX2| HM:PFM:NREP 2 HM:PFM:REP 114->245|PF00116|6.6e-43|52.5|120/120|COX2| HM:PFM:REP 15->101|PF02790|4.9e-23|24.4|82/84|COX2_TM| GO:PFM:NREP 8 GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF02790|IPR011759| GO:PFM GO:0005507|"GO:copper ion binding"|PF02790|IPR011759| GO:PFM GO:0009055|"GO:electron carrier activity"|PF02790|IPR011759| GO:PFM GO:0016021|"GO:integral to membrane"|PF02790|IPR011759| GO:PFM GO:0022900|"GO:electron transport chain"|PF02790|IPR011759| GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF00116|IPR002429| GO:PFM GO:0005507|"GO:copper ion binding"|PF00116|IPR002429| GO:PFM GO:0016020|"GO:membrane"|PF00116|IPR002429| RP:SCP:NREP 2 RP:SCP:REP 14->102|1ar1B2|3e-19|37.1|89/107|f.17.2.1| RP:SCP:REP 111->263|1ar1B1|1e-34|49.3|144/145|b.6.1.2| HM:SCP:REP 3->109|1ar1B2|1.2e-25|31.8|107/107|f.17.2.1|1/1|Cytochrome c oxidase subunit II-like, transmembrane region| HM:SCP:REP 110->264|1m56B1|1.8e-48|50.7|146/0|b.6.1.2|1/1|Cupredoxins| OP:NHOMO 617 OP:NHOMOORG 484 OP:PATTERN 11------------------1---111111-------------------------------------- 11411111111-1-11111-1111111111111----11-111111111111111111111111--11111------------1---------------------11111--------------------------11111---11121211-1111--21111112323211111111111111-11------11111111111111111----111111-111------111---------------------------------------------------------------------------------------------------------------------1---------------------1-11112-----12211331121221111111-111122432423331-211133224343111112112222111--------111-112-111111111111111111111111-111111111--111232222321111222322222122423221122221111112141211111111-------1133211-----11---111-1-1-1111-222222--------------------------------211111111111111111111111111---31-1--------------------------------------------------------------------------------------------1-----1111111---------------------------2111111111211112----------------2-----111111111111111----11--111111----------------------------------------------12- 11------1-----1--1---------111-11111-------111-1------121-1---1-111---1-----1----------------1---11-1--111------11111-----1-11-1-16--11-----1--11--------1-1-------2--12--1-11-122----1--1--1--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 271 STR:RPRED 94.4 SQ:SECSTR #########cEEEcccTTcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcTTTccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEETTEEEEEEGGcGTTTTEEEEEccTTcGGGHcccHHTTccccccHHHHHcEEEETTcEEEEEEEEcHTcccEEEEEGGGTEEEEEccTccEEEEEEccccEEEEEcccccccTTGGGccEEEEEEcHHHHHHHHHHHHHHTccHHHHHHccccccccEEc####### DISOP:02AL 259-271,281-288| PSIPRED cHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccEEEcccccccccEEEEEEcccHHHHHcccccccccccEEEEccccEEEEccccEEEEEEcccccEEEEEHHHHcccccccccccHHHHHHHHcccccccccHHHHHccccccccEEEEEEcHHHHHHHHHHHHHHHccccHHHHHccccccccEEEcccccc //