[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : coxC
DDBJ      :coxC         cytochrome c oxidase subunit III
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  342/915 : Eukaryota  57/199 : Viruses  0/175   --->[See Alignment]
f.25.1
:291 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->283 1m56C PDBj 8e-81 54.2 %
:RPS:PDB   76->262 2dysC PDBj 5e-23 32.6 %
:RPS:SCOP  5->283 1m56C  f.25.1.1 * 5e-65 56.5 %
:HMM:SCOP  4->283 1qleC_ f.25.1.1 * 2.4e-95 50.9 %
:RPS:PFM   65->280 PF00510 * COX3 1e-54 55.8 %
:RPS:PFM   263->290 PF05297 * Herpes_LMP1 5e-04 46.4 %
:HMM:PFM   9->283 PF00510 * COX3 3.8e-99 48.4 256/258  
:BLT:SWISS 7->284 COX3_SOYBN 4e-73 51.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86580.1 GT:GENE coxC GT:PRODUCT cytochrome c oxidase subunit III GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 767408..768283 GB:FROM 767408 GB:TO 768283 GB:DIRECTION + GB:GENE coxC GB:PRODUCT cytochrome c oxidase subunit III GB:PROTEIN_ID AAK86580.1 GB:DB_XREF GI:15155746 GB:GENE:GENE coxC LENGTH 291 SQ:AASEQ MADTHQKNHDYHIIDPSPWPLLASIGAFIMTFGGVCYMRYLSGGSFKLFGAELANPWLFYIGLVIVLYVMYAWWADTIKEANEGSHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLFPHEAIQASRLEYTGGQWPPKGIEVIDPWHLPLYNTVILLLSGTCVTWAHHALLHNDRKGLISGLALTVALGVLFSTVQVYEYIHAPFDFKNSIYGATFFMATGFHGFHVFVGTVFLLVCLFRAIAGGFTPKQHFGFEAAAWYWHFVDVVWLFLFFAIYIWGGWGAPLHG GT:EXON 1|1-291:0| BL:SWS:NREP 1 BL:SWS:REP 7->284|COX3_SOYBN|4e-73|51.4|259/265| TM:NTM 7 TM:REGION 17->39| TM:REGION 56->78| TM:REGION 95->117| TM:REGION 151->173| TM:REGION 181->203| TM:REGION 222->244| TM:REGION 264->286| SEG 224->240|tgfhgfhvfvgtvfllv| BL:PDB:NREP 1 BL:PDB:REP 5->283|1m56C|8e-81|54.2|262/265| RP:PDB:NREP 1 RP:PDB:REP 76->262|2dysC|5e-23|32.6|178/258| RP:PFM:NREP 2 RP:PFM:REP 65->280|PF00510|1e-54|55.8|208/212|COX3| RP:PFM:REP 263->290|PF05297|5e-04|46.4|28/301|Herpes_LMP1| HM:PFM:NREP 1 HM:PFM:REP 9->283|PF00510|3.8e-99|48.4|256/258|COX3| GO:PFM:NREP 5 GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF00510|IPR000298| GO:PFM GO:0006123|"GO:mitochondrial electron transport, cytochrome c to oxygen"|PF00510|IPR000298| GO:PFM GO:0016020|"GO:membrane"|PF00510|IPR000298| GO:PFM GO:0016021|"GO:integral to membrane"|PF05297|IPR007961| GO:PFM GO:0019087|"GO:transformation of host cell by virus"|PF05297|IPR007961| RP:SCP:NREP 1 RP:SCP:REP 5->283|1m56C|5e-65|56.5|262/265|f.25.1.1| HM:SCP:REP 4->283|1qleC_|2.4e-95|50.9|271/273|f.25.1.1|1/1|Cytochrome c oxidase subunit III-like| OP:NHOMO 455 OP:NHOMOORG 407 OP:PATTERN ------------------------21111111------------------------------------ ---1--1111111111111-141111111111211211111111-1-111112111----1111112-------------------------------------------------------------------------------13221111111212-1221115331111-11112--11-111-----1-----------------1111----1-121---------1---------------------------------------------------------------------------------------------------------------------1------------------------1111-----111112211111111111112112-11111111111-111111111111111111111111111--------1---111-112111111111111111111111-111111111--1111111111211111122111121112111111111111111111111111-2111-------113111--------------------------------------------------------------111111111111111111111111111---11-1--------------------------------------------------------------------------------------------1-----1111111---------------------------1111112111111111-------------1--1-----111111111111111----11-------------------------------------------------------1- -----------------1---------111-11111-------2-1--------131-----1-111---1-----1----------------1---11----111------11111-----1-21-1-14--11-----1--11--------1-1-------1-112--1-11-111----------1-1---1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 95.2 SQ:SECSTR ###cTTccccccccccccHHHHHHHHHHHHHHHHHHHHTccc#Tc##ccccccccTHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccGGGccTcTTTcTcccccTTcccccTTcHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccccHHHHHHHHHHHHHHHHHHHHHHHHTTTc######## DISOP:02AL 1-6, 290-291| PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //