[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ctpA
DDBJ      :ctpA         components of type IV pilus, pilin subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->54 PF04964 * Flp_Fap 2e-06 61.7 %
:HMM:PFM   8->54 PF04964 * Flp_Fap 8.1e-25 68.1 47/47  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86042.2 GT:GENE ctpA GT:PRODUCT components of type IV pilus, pilin subunit GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(229627..229818) GB:FROM 229627 GB:TO 229818 GB:DIRECTION - GB:GENE ctpA GB:PRODUCT components of type IV pilus, pilin subunit GB:PROTEIN_ID AAK86042.2 GB:DB_XREF GI:159139547 GB:GENE:GENE ctpA LENGTH 63 SQ:AASEQ MTKIFARFLKDESGATAIEYGLIAALISVAIIGGASTLGGKLKDTFTFIGKSFTDSKASTGGV GT:EXON 1|1-63:0| TM:NTM 1 TM:REGION 16->38| RP:PFM:NREP 1 RP:PFM:REP 8->54|PF04964|2e-06|61.7|47/47|Flp_Fap| HM:PFM:NREP 1 HM:PFM:REP 8->54|PF04964|8.1e-25|68.1|47/47|Flp_Fap| OP:NHOMO 15 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11--1111122--1-----------------------------------------------------------------------1----------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,59-59,62-64| PSIPRED cHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccc //