[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : dapA.2
DDBJ      :dapA         dihydrodipicolinate synthase
Swiss-Prot:DAPA_AGRT5   RecName: Full=Dihydrodipicolinate synthase;         Short=DHDPS;         EC=4.2.1.52;

Homologs  Archaea  61/68 : Bacteria  859/915 : Eukaryota  146/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:294 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->293 2vc6A PDBj 4e-92 57.9 %
:RPS:PDB   1->293 3cprA PDBj 1e-86 36.8 %
:RPS:SCOP  2->288 1f5zA  c.1.10.1 * 1e-88 27.8 %
:HMM:SCOP  1->293 1dhpA_ c.1.10.1 * 3.9e-104 49.1 %
:RPS:PFM   3->287 PF00701 * DHDPS 2e-72 53.7 %
:HMM:PFM   1->291 PF00701 * DHDPS 1.5e-100 46.4 289/289  
:BLT:SWISS 1->294 DAPA_AGRT5 e-169 100.0 %
:PROS 38->55|PS00665|DHDPS_1
:PROS 133->164|PS00666|DHDPS_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86832.1 GT:GENE dapA.2 GT:PRODUCT dihydrodipicolinate synthase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1017629..1018513 GB:FROM 1017629 GB:TO 1018513 GB:DIRECTION + GB:GENE dapA GB:PRODUCT dihydrodipicolinate synthase GB:PROTEIN_ID AAK86832.1 GB:DB_XREF GI:15156044 GB:GENE:GENE dapA LENGTH 294 SQ:AASEQ MFKGSIPALITPFTDNGSVDEKAFAAHVEWQIAEGSNGLVPVGTTGESPTLSHDEHKRVVELCIEVAAKRVPVIAGAGSNNTDEAIELALHAQEAGADALLVVTPYYNKPTQKGLFAHFSAVAEAVKLPIVIYNIPPRSVVDMSPETMGALVKAHKNIIGVKDATGKLDRVSEQRISCGKDFVQLSGEDGTALGFNAHGGVGCISVTANVAPRLCSEFQAAMLAGDYAKALEYQDRLMPLHRAIFMEPGVCGTKYALSKTRGGNRRVRSPLMSTLEPATEAAIDAALKHAGLMN GT:EXON 1|1-294:0| SW:ID DAPA_AGRT5 SW:DE RecName: Full=Dihydrodipicolinate synthase; Short=DHDPS; EC=4.2.1.52; SW:GN Name=dapA; OrderedLocusNames=Atu1024; ORFNames=AGR_C_1883; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Diaminopimelate biosynthesis; Lyase; Lysine biosynthesis; Schiff base. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->294|DAPA_AGRT5|e-169|100.0|294/294| GO:SWS:NREP 5 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0019877|"GO:diaminopimelate biosynthetic process"|Diaminopimelate biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0009085|"GO:lysine biosynthetic process"|Lysine biosynthesis| PROS 38->55|PS00665|DHDPS_1|PDOC00569| PROS 133->164|PS00666|DHDPS_2|PDOC00569| BL:PDB:NREP 1 BL:PDB:REP 1->293|2vc6A|4e-92|57.9|290/291| RP:PDB:NREP 1 RP:PDB:REP 1->293|3cprA|1e-86|36.8|288/301| RP:PFM:NREP 1 RP:PFM:REP 3->287|PF00701|2e-72|53.7|283/288|DHDPS| HM:PFM:NREP 1 HM:PFM:REP 1->291|PF00701|1.5e-100|46.4|289/289|DHDPS| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00701|IPR002220| GO:PFM GO:0016829|"GO:lyase activity"|PF00701|IPR002220| RP:SCP:NREP 1 RP:SCP:REP 2->288|1f5zA|1e-88|27.8|284/293|c.1.10.1| HM:SCP:REP 1->293|1dhpA_|3.9e-104|49.1|291/0|c.1.10.1|1/1|Aldolase| OP:NHOMO 2341 OP:NHOMOORG 1066 OP:PATTERN 111---224444444221121111211122211111111111111111111111111-1122222--- 3261423133312122211-15112411111254443497111115311331254213--1122316766211114113221311111342312111111111122132511111111111111111111111111111111111111111111111111111111111111111111111113--221112122222222222222227244322221332411111111241222222222222222112211--11-1-1-3311121211111111111111211333333332331111111111111211111111212124111111121235111222111--113112211111122211211121511111111121C681234433233333333336-21511F146611C776BD7ECC77742122445144235111111113121121311-11111111111111111111111111111112454347AA69783332666744443685732551256421422537388121121231111111111111111111111211111211111111111113111111212211211111111111111111222211211312111111211112111122--1111111111143623314224443422-22422332222542232222534323332323233333232234222222211111111111111111111111121111335222222222222222553542212121443554462576214331----1---122311111112112112323322211111112111111----------1--------1--------1---1---1111112111112 ---------------22557655675633222233312221122223455AADB89723222-14-------523--------------423222133311-1312--4-5212225111112-2215-892-425221-2-221-211-2-121322422113312--11--211111J1111232145311241122 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 99.7 SQ:SECSTR HHccEEEEccccccTTccccHHHHHHHHHHHHHTTccEEEEccTTTTTTTccHHHHHHHHHHHHHHHTTTcEEEEEcccccHHHHHHHHHHHHHTTccEEEEEccccccccHHHHHHHHHHHHHHccccEEEEEcHHHHcccccHHHHHHHTTHcTTEEEEEEccccHHHHHHHHHHHHHccEEEEccGGGHHHHHHTTccEEEEcGGGTcHHHHHHHHHHHHHTcHHHHHHHHHHTHHHHHHHHHHcHHHHHHHHHHHTTcccccccTTccccccHHHHHHHHHHHHHTTcc# PSIPRED ccccccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccHHHccHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccc //