[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : dapD
DDBJ      :dapD         2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
Swiss-Prot:DAPD_AGRT5   RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase;         EC=2.3.1.117;AltName: Full=Tetrahydrodipicolinate N-succinyltransferase;         Short=THP succinyltransferase;         Short=Tetrahydropicolinate succinylase;         Short=THDP succinyltransferase;

Homologs  Archaea  7/68 : Bacteria  538/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->284 3eg4A PDBj e-136 81.7 %
:RPS:PDB   5->284 3bxyA PDBj 2e-56 66.2 %
:RPS:SCOP  6->283 1kgqA  b.81.1.2 * e-119 65.6 %
:HMM:SCOP  6->268 1tdtA_ b.81.1.2 * 3.1e-71 36.1 %
:HMM:PFM   157->173 PF00132 * Hexapep 0.0009 47.1 17/18  
:BLT:SWISS 1->284 DAPD_AGRT5 e-165 100.0 %
:PROS 141->169|PS00101|HEXAPEP_TRANSFERASES

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86188.2 GT:GENE dapD GT:PRODUCT 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(364949..365803) GB:FROM 364949 GB:TO 365803 GB:DIRECTION - GB:GENE dapD GB:PRODUCT 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase GB:PROTEIN_ID AAK86188.2 GB:DB_XREF GI:159139604 GB:GENE:GENE dapD LENGTH 284 SQ:AASEQ MSLTDLTSLETIIETAFDNRDGVNVSTKGEVRDAVNTSLQLLDSGKVRVAEKQADGNWKVNQWLKKAVLLSFRLNDMEIVTGGPGESTWWDKVPSKFENWGENQFRAAGFRAVPNAVVRRSAYVAKNVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEVVEGCIVREGAVLGMGVFIGKSTKIVDRATGEITYGEVPPYSVVVAGTMPGKPFPNGEPGPSLYCAVIVKRVDEKTRSKTGINELLRD GT:EXON 1|1-284:0| SW:ID DAPD_AGRT5 SW:DE RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; EC=2.3.1.117;AltName: Full=Tetrahydrodipicolinate N-succinyltransferase; Short=THP succinyltransferase; Short=Tetrahydropicolinate succinylase; Short=THDP succinyltransferase; SW:GN Name=dapD; OrderedLocusNames=Atu0371; ORFNames=AGR_C_648; SW:KW Acyltransferase; Amino-acid biosynthesis; Complete proteome;Cytoplasm; Diaminopimelate biosynthesis; Lysine biosynthesis; Repeat;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->284|DAPD_AGRT5|e-165|100.0|284/284| GO:SWS:NREP 6 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0019877|"GO:diaminopimelate biosynthetic process"|Diaminopimelate biosynthesis| GO:SWS GO:0009085|"GO:lysine biosynthetic process"|Lysine biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 141->169|PS00101|HEXAPEP_TRANSFERASES|PDOC00094| BL:PDB:NREP 1 BL:PDB:REP 6->284|3eg4A|e-136|81.7|279/279| RP:PDB:NREP 1 RP:PDB:REP 5->284|3bxyA|2e-56|66.2|269/275| HM:PFM:NREP 1 HM:PFM:REP 157->173|PF00132|0.0009|47.1|17/18|Hexapep| RP:SCP:NREP 1 RP:SCP:REP 6->283|1kgqA|e-119|65.6|270/274|b.81.1.2| HM:SCP:REP 6->268|1tdtA_|3.1e-71|36.1|255/0|b.81.1.2|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 550 OP:NHOMOORG 547 OP:PATTERN ------------------------1--11111---------------------1-------------- 11111-----------------------------------1111--------------------------1-------1--11--111--------11111111111111---------------11111111111-------------------------------------------------------111111111111111111111111111111-11-------111111111111111111111111-----1-1-1111---1-1-1----------1--11111111111-------------1111111111-1-111111111111-1111111----------------------1---11--111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111-11111--1111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-----------------------111111-----------------------1---111111--21-2-1111111111111111111--1111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111----1111-11111-11111111111111-------------------1----1---1--------------111111111111111121------------------------------------------1111111111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 284 STR:RPRED 100.0 SQ:SECSTR cHHHcHHHHHHHHHHHHHTGGGccTTTccHHHHHHHHHHHHHHHTccccEEEETTTEEEEcHHHHHHHHHHHHHcccEEEEcEccccEEEEccccTTTTccHHHHHHHccEEcTTcEEcTTcEEcTTcEEccEEEcTTcEEcTTcEEcTTEEEcTTcEEcTTcEEcTTcEEccccccTTccccEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTccEEETTTccEEccEEcTTEEEEEEEEEccccTTcccccEEEEEEEEEEccGGGccHccHHHHHHc DISOP:02AL 1-6,280-280,284-285| PSIPRED cccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEHHHccEEEEEEEccccEEEcccccccccccccccccccccHHHHHHccccccccEEEccccEEccccEEEcEEEccccEEccccEEccccEEccccEEccccEEccccEEccccccccccccEEccccEEccccEEcccEEEccccEEccccEEcccccccEEEEEEEEEEEcccccEEEccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHcc //