[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : dnaJ.3
DDBJ      :dnaJ         molecular chaperone, DnaJ family
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  147/915 : Eukaryota  107/199 : Viruses  1/175   --->[See Alignment]
a.2.3
:200 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->64 2ochA PDBj 3e-11 46.7 %
:RPS:PDB   3->67 2dn9A PDBj 1e-13 44.6 %
:RPS:SCOP  3->66 1gh6A  a.2.3.1 * 5e-14 35.9 %
:HMM:SCOP  1->66 1gh6A_ a.2.3.1 * 2.6e-18 47.0 %
:RPS:PFM   3->60 PF00226 * DnaJ 2e-05 48.3 %
:HMM:PFM   3->61 PF00226 * DnaJ 6.7e-21 47.5 59/64  
:HMM:PFM   153->185 PF10046 * BLOC1_2 0.00025 33.3 33/99  
:BLT:SWISS 5->66 DNJH_CUCSA 2e-13 48.4 %
:PROS 41->60|PS00636|DNAJ_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87761.1 GT:GENE dnaJ.3 GT:PRODUCT molecular chaperone, DnaJ family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1968719..1969321) GB:FROM 1968719 GB:TO 1969321 GB:DIRECTION - GB:GENE dnaJ GB:PRODUCT molecular chaperone, DnaJ family GB:PROTEIN_ID AAK87761.1 GB:DB_XREF GI:15157129 GB:GENE:GENE dnaJ LENGTH 200 SQ:AASEQ MIDPYVLLGVERDADEAAIKTAYRKVAKAAHPDSGGDGEQFARLQTAYELLKDPVRRRVFDDTGYDPQLADAKDLKGLLMLETLVNEFILDEREPGSFDPVAAMRRKLTDDILKSRFHILELERHRTRVRKHMDRLGRKPETDVLSSMLRARSQSIAEAIRNAETQIEAIEQAYTMLEGYSYELETVTLAEPLLKGEAAE GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 5->66|DNJH_CUCSA|2e-13|48.4|62/413| PROS 41->60|PS00636|DNAJ_1|PDOC00553| BL:PDB:NREP 1 BL:PDB:REP 5->64|2ochA|3e-11|46.7|60/66| RP:PDB:NREP 1 RP:PDB:REP 3->67|2dn9A|1e-13|44.6|65/79| RP:PFM:NREP 1 RP:PFM:REP 3->60|PF00226|2e-05|48.3|58/63|DnaJ| HM:PFM:NREP 2 HM:PFM:REP 3->61|PF00226|6.7e-21|47.5|59/64|DnaJ| HM:PFM:REP 153->185|PF10046|0.00025|33.3|33/99|BLOC1_2| GO:PFM:NREP 1 GO:PFM GO:0031072|"GO:heat shock protein binding"|PF00226|IPR001623| RP:SCP:NREP 1 RP:SCP:REP 3->66|1gh6A|5e-14|35.9|64/114|a.2.3.1| HM:SCP:REP 1->66|1gh6A_|2.6e-18|47.0|66/0|a.2.3.1|1/1|Chaperone J-domain| OP:NHOMO 412 OP:NHOMOORG 258 OP:PATTERN -------------------------------1------------------------------11---- ---11------------11-1-1111111111-1111---1--1----111-11--11----1111-11111111----1112---------------------11-1----------------------------11111--------------111111-1---------11-1--11-1-12------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1-1------1-----1---------1-11211-111-1----------1-11111-1---1-21123323332211-----1----------------------1------------------------------21121-----------------------------------------------------------------1---------1---------------------1------------------------------11----------------------------------1-------------------------------------------------------------------------------1-------------------------1-----------------------------------------------1111111111--------------11111111111111--1---------------------------------------1-----1--------1- 1-11----1-1----1--1-32--2-111-1221111322132111--11----11-121221----11------------1111111-322-3221112231----27-4-----------1------281-21-----1--1--1---1--------111-2--141--122-4443J433238696-552111128 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- STR:NPRED 77 STR:RPRED 38.5 SQ:SECSTR cccHHHHHTccTTccHHHHHHHHHHHHHHTcTTTcTHHHHHHHHHHHHHHHHcHHHHHHHHHcccccHcccHHHHHc########################################################################################################################### DISOP:02AL 67-78, 99-109, 197-200| PSIPRED cccHHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccc //