[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : dppD.2
DDBJ      :dppD         ABC transporter, nucleotide binding/ATPase protein (dipeptide)
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  902/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:276 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   2->231 3dhwC PDBj 5e-22 32.6 %
:RPS:PDB   2->230 3b5jA PDBj 8e-33 25.7 %
:RPS:PDB   206->264 2bboA PDBj 3e-05 6.8 %
:RPS:SCOP  2->255 1b0uA  c.37.1.12 * 1e-33 25.5 %
:HMM:SCOP  5->230 1ii8.1 c.37.1.12 * 2e-50 31.0 %
:RPS:PFM   51->180 PF00005 * ABC_tran 3e-10 33.1 %
:HMM:PFM   51->180 PF00005 * ABC_tran 9.3e-16 29.3 116/118  
:HMM:PFM   231->262 PF08352 * oligo_HPY 2e-06 37.5 32/64  
:HMM:PFM   28->56 PF01935 * DUF87 1.9e-05 48.3 29/229  
:BLT:SWISS 1->265 Y4TR_RHISN 4e-58 46.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88246.1 GT:GENE dppD.2 GT:PRODUCT ABC transporter, nucleotide binding/ATPase protein (dipeptide) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2483797..2484627) GB:FROM 2483797 GB:TO 2484627 GB:DIRECTION - GB:GENE dppD GB:PRODUCT ABC transporter, nucleotide binding/ATPase protein (dipeptide) GB:PROTEIN_ID AAK88246.1 GB:DB_XREF GI:15157704 GB:GENE:GENE dppD LENGTH 276 SQ:AASEQ MLVEIENLKIAFQTRTSRFEAVRGVSMKLGTEKLGIVGESGSGKSLTARALMKLLPSNADIRADKLAFDGIDVLSASEKQMRQIRGKRAGFILQDPKYSLNPVKTMGAQIAEAWRAHKGGSKRAAMEAAIALLDQVKIRNPRQVASSYAHEVSGGMGQRVMIAMMLAPDPELLIADEPTSALDATVQAEILRLIEELVSERGMGLILISHDLPLVSHFCDRVAVMYSGRVMEELKASELLKAEHPYTKGLLNCIPSLTHPRERLPVLNRDAAWSSQ GT:EXON 1|1-276:0| BL:SWS:NREP 1 BL:SWS:REP 1->265|Y4TR_RHISN|4e-58|46.0|265/335| SEG 232->243|eelkasellkae| BL:PDB:NREP 1 BL:PDB:REP 2->231|3dhwC|5e-22|32.6|215/343| RP:PDB:NREP 2 RP:PDB:REP 2->230|3b5jA|8e-33|25.7|214/243| RP:PDB:REP 206->264|2bboA|3e-05|6.8|59/254| RP:PFM:NREP 1 RP:PFM:REP 51->180|PF00005|3e-10|33.1|121/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 51->180|PF00005|9.3e-16|29.3|116/118|ABC_tran| HM:PFM:REP 231->262|PF08352|2e-06|37.5|32/64|oligo_HPY| HM:PFM:REP 28->56|PF01935|1.9e-05|48.3|29/229|DUF87| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 2->255|1b0uA|1e-33|25.5|243/258|c.37.1.12| HM:SCP:REP 5->230|1ii8.1|2e-50|31.0|216/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 30238 OP:NHOMOORG 1156 OP:PATTERN JJE7GCE9QQPPPOSBYDCEBBAHcFJaSKUICAC9A9CBD98KONNbFN*qb9MRJGKHICDAL176 FLUC*OMNTTUJLGKIHDD-DM44HuDDDDD8TQRQTuuy9eHlXpkUXYUIjfaJIU67XbRXuZmzw*NQPPPdQPIFjOT88A8AFEDB2B87B--78D9FBK9FCF57777779989999ADGCLJFFLELKSTTaeAACbIZNPeNNPOSGKA797B7RKJOnhbJ7F86666E6787RIKBAcY5JNdxy*w*x**j***yw**qpppl***QVe*oWWYeebcZ**OVWWUWWVWWWWVWVNQPOLjSOPheOGPKOZXFFfiPLJNWSQUTcabZdYfVYWYaZXVUXaWYXVTVUTVWVWWVTUYSQQPQUUUVV*irvprplptjRoRYmddLPQNubQaNpNVKD**YXMRYZIRTRdTCRSIERLJJFFCDBDPG***IGTqibsZrvsuuqxmqr*-TTySOpQs**H5*************t9DGbq*yox*qosBABBBBBBWMPDDLLt664343332223222222322322343548B9BA9m**jv******pkjkg****rnqpUp***inyd7AfdZbQZVXqX*p**PWTELCGWIBBDCDCCKIHKTNLaqDQNUUGOUOMUAVPPMNNUKQECEGYhLZ7FEJ8GFFGGD898888888CIABAEFcdbFkJQDNHgHJJKLIINKHIJJNPJLPK5-8COKF------ug**Rwhijiiiiiief-ihigjggffgikgefheea*****UXWabXYaZZZYZaXZXYZ*eabbbafO1yzzz**zvx***12FDAA89ACDCBHEpa*RRQONMFJKKIOKPYJLMLLALAGNbRikgje*u*hkkbgP***AA978999AFVgdkegffgpomqpJJGECEECDC998943BHJJEECD67646544g5JBCDA7-B8A7CB988A7DAA87554NOXIGardaX9MI ----872-78-124555213325426444243455633443442315514759454521111-1212-111113411-21-1112112-6525544542521421135FEA153468111255498-D3GgB1A5A65219327433213B43S4746P5Ba2M851J32BCA93565-a25331JFGd2LG37K5CB7 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 256-276| PSIPRED cEEEEEccEEEEEccccEEEEEccccEEEcccEEEEEEEccccHHHHHHHHHHHcccccEEEEEEEEEccEEHHcccHHHHHHHHHHHcEEEEccHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHHHccEEEEEEcHHHHcccccHHHHHHHHHccccccccccccccccccccccc //