[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : dppF.1
DDBJ      :dppF         ABC transporter, nucleotide binding/ATPase protein (dipeptide)
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:246 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->232 3dhwC PDBj 5e-32 37.6 %
:RPS:PDB   2->232 3dmdC PDBj 1e-43 10.8 %
:RPS:SCOP  1->232 1b0uA  c.37.1.12 * 2e-43 30.9 %
:HMM:SCOP  4->215 1ii8.1 c.37.1.12 * 1.8e-63 35.7 %
:RPS:PFM   41->163 PF00005 * ABC_tran 6e-20 51.8 %
:HMM:PFM   41->163 PF00005 * ABC_tran 1.9e-23 37.8 111/118  
:HMM:PFM   17->47 PF01580 * FtsK_SpoIIIE 8.9e-05 38.7 31/205  
:BLT:SWISS 10->232 APPF_BACSU 4e-51 46.4 %
:PROS 135->149|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK88245.2 GT:GENE dppF.1 GT:PRODUCT ABC transporter, nucleotide binding/ATPase protein (dipeptide) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2483060..2483800) GB:FROM 2483060 GB:TO 2483800 GB:DIRECTION - GB:GENE dppF GB:PRODUCT ABC transporter, nucleotide binding/ATPase protein (dipeptide) GB:PROTEIN_ID AAK88245.2 GB:DB_XREF GI:159140511 GB:GENE:GENE dppF LENGTH 246 SQ:AASEQ MIDVDNLRIKFGDREVVKGVSFSVEKGGSFGIVGESGSGKSTILRAMAGLNESWEGRIAFAGKDAPLKRTPDFFRQVQMVFQDPYGSLHPRQTIDRILSELPLVHGMDNIEKRIQQALSDVALPQAVRFRFPHQLSGGQRQRVAIARALIADPEVLLLDEPTSALDVSVQAEILNLLQDLRAARNLTYILVSHNLAVIAHLCPQVGVMLNGEMVEQLSAGDLREGRTKHPHTEELRSLSIRLEEPA GT:EXON 1|1-246:0| BL:SWS:NREP 1 BL:SWS:REP 10->232|APPF_BACSU|4e-51|46.4|222/329| PROS 135->149|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 233->244|eelrslsirlee| BL:PDB:NREP 1 BL:PDB:REP 1->232|3dhwC|5e-32|37.6|226/343| RP:PDB:NREP 1 RP:PDB:REP 2->232|3dmdC|1e-43|10.8|212/318| RP:PFM:NREP 1 RP:PFM:REP 41->163|PF00005|6e-20|51.8|112/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 41->163|PF00005|1.9e-23|37.8|111/118|ABC_tran| HM:PFM:REP 17->47|PF01580|8.9e-05|38.7|31/205|FtsK_SpoIIIE| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->232|1b0uA|2e-43|30.9|230/258|c.37.1.12| HM:SCP:REP 4->215|1ii8.1|1.8e-63|35.7|207/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 52404 OP:NHOMOORG 1173 OP:PATTERN TTMAPKLFXXXTXSZRkLRSNPNYyPTmnWiUHDDEFEJIJHFUaUVmMT**l8VgVXZRSMKHY18B UawN*bkgmmoUdUWWYML-LqBBc*MMMMMUxqrrv***O*d*y**grpkP***RUlEEx**k*u****ibbbb*dcZT*kkCDEBCWVVP4TGIK--HGXLLJfNbRYBAAAAAACDCCCCCJURMUWPPUVcRqzz**LKL*avqq*pombjXYQJNKPPilak***hHVLPHJIRIOIHhaeQMwn9Yi*************************jr***ks*z*ywx**Xpqqqqnloqpppooghdee*ndh**gTifq**OP**fYTbnkhmmutxsvo**wvw*xuusy*syvdgbacefghgfcd*onjijonpkp***********k*kx***clkg*sl*w*isRI**tnZfhpScohvlRdbYMgYYYOKNNMPgZ***UUq****************-kp*jc*l***PA**************KNM**********XWXXXXXXsWbNTfd*55666555764698AB7AC89999A87A5IGFFEI***************w********i********ANyxt*owoo*z****aopPaNRoaKLLJKKKUUUaiedy*TjXusakwfdqLideaYcnXcYUVZy*ayONNUGHHIMGHFDEFEEFEEKVJHKTSvuuS*XhNXQzVcdebRXlbYYaXbhecgg5-FMVQQ321444****h************-************************pnnuxrstvvuuursussr**wz****Z5************34NJEGDEEPRSRTL*p*bcbbfbLSXTQVSXnRTWUTKWLPWtg**y*****z****i***IGEEEHGEGKlyx*xyyyy*****UVTQPRQNPPGEFE88NVUULLMN997A9AA9*EcDCDBE-GFEDJJERRNAHMEFFAABdltaau*wutGfO 3255hgK-eM9BZjTFFGDIOSLXGVLGGDFEFQNLEOKKJKJECCLKKSPPcSHHKFFDFEE8E9AA5884EEEA92A9B9AB8C47-PQAFKLEIBBEC9FNGL8Rjj*ZdVqjoHGDGIXJtpE*D**w4yVuLJGDkHJ*ZDRJG9fDE*FhNTyMp*OzWfD*fm*rljQJPMJ*MOIOU*sr*E**MT*qzxW ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 242-247| PSIPRED cEEEEcEEEEccEEEEEccccEEEccccEEEEEEcccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHcEEEEccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHccHHHccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHHHccEEEEEEcHHHHHHcccccHHHHHHHHHcccccccc //