[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : dskA
DDBJ      :dskA         dnaK suppressor protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.14g.39.1
:106 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  75->106 1tjlA2  g.39.1.13 * 4e-06 37.5 %
:HMM:SCOP  2->74 1tjlA1 a.2.14.1 * 4.5e-06 34.2 %
:HMM:SCOP  75->106 1tjlA2 g.39.1.13 * 9.4e-07 40.6 %
:HMM:PFM   73->104 PF01258 * zf-dskA_traR 8.6e-12 43.8 32/36  
:BLT:SWISS 29->103 Y250_AQUAE 4e-09 36.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL41919.2 GT:GENE dskA GT:PRODUCT dnaK suppressor protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 896410..896730 GB:FROM 896410 GB:TO 896730 GB:DIRECTION + GB:GENE dskA GB:PRODUCT dnaK suppressor protein GB:PROTEIN_ID AAL41919.2 GB:DB_XREF GI:159139833 GB:GENE:GENE dskA LENGTH 106 SQ:AASEQ MNVESYEKILRDRQRELYRRLHKIEADFEEPRNPDDEDRASERSNDEVLDELGQVGQDELRAIDAALARIASGTFGTCVKCGKRISEDRLKAVPYTPFCQECAAAL GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 29->103|Y250_AQUAE|4e-09|36.0|75/145| SEG 58->71|delraidaalaria| HM:PFM:NREP 1 HM:PFM:REP 73->104|PF01258|8.6e-12|43.8|32/36|zf-dskA_traR| RP:SCP:NREP 1 RP:SCP:REP 75->106|1tjlA2|4e-06|37.5|32/41|g.39.1.13| HM:SCP:REP 2->74|1tjlA1|4.5e-06|34.2|73/0|a.2.14.1|1/1|DnaK suppressor protein DksA, alpha-hairpin domain| HM:SCP:REP 75->106|1tjlA2|9.4e-07|40.6|32/41|g.39.1.13|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--11--11-----1------1------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 19-37| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHHcccccHHHHHccccccccHHHHHcc //