[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fabH.1
DDBJ      :fabH         3-oxoacyl-(acyl-carrier-protein) synthase III
Swiss-Prot:FABH_AGRT5   RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3;         EC=2.3.1.180;AltName: Full=3-oxoacyl-[acyl-carrier-protein] synthase III;AltName: Full=Beta-ketoacyl-ACP synthase III;         Short=KAS III;

Homologs  Archaea  1/68 : Bacteria  818/915 : Eukaryota  23/199 : Viruses  0/175   --->[See Alignment]
c.95.1
:323 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   8->323 2ebdB PDBj 4e-73 45.9 %
:RPS:PDB   7->323 1b65A PDBj 1e-39 10.0 %
:RPS:SCOP  8->174 1eblA1  c.95.1.2 * 1e-54 43.1 %
:RPS:SCOP  207->323 1u0mA2  c.95.1.2 * 6e-27 19.7 %
:HMM:SCOP  8->323 1tedA_ c.95.1.2 * 2.9e-71 35.7 %
:RPS:PFM   107->190 PF08545 * ACP_syn_III 2e-25 67.1 %
:RPS:PFM   235->322 PF08541 * ACP_syn_III_C 4e-22 48.9 %
:HMM:PFM   235->323 PF08541 * ACP_syn_III_C 2.6e-39 58.4 89/90  
:HMM:PFM   107->190 PF08545 * ACP_syn_III 1.3e-35 66.2 80/80  
:HMM:PFM   50->146 PF00108 * Thiolase_N 8.3e-06 27.1 96/264  
:BLT:SWISS 1->323 FABH_AGRT5 e-164 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86983.1 GT:GENE fabH.1 GT:PRODUCT 3-oxoacyl-(acyl-carrier-protein) synthase III GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1172561..1173532 GB:FROM 1172561 GB:TO 1173532 GB:DIRECTION + GB:GENE fabH GB:PRODUCT 3-oxoacyl-(acyl-carrier-protein) synthase III GB:PROTEIN_ID AAK86983.1 GB:DB_XREF GI:15156221 GB:GENE:GENE fabH LENGTH 323 SQ:AASEQ MIRSIVRGFGAALPKRVMTNSEIEGVVETSDEWIVQRTGIRQRYIAGEGETTASLGEAAARAALDNAGLTPADIDLIILATSTPDNTFPATAVNIQNRLGMTHGFAFDMQAVCSGFVYAVATADLYIRGGMAKRVLVIGAETFSRILDWKDRTTCVLFGDGAGALVIEAGEGEGTSSDRGILTSQLRSDGSHKDKLYVDGGPSTTGTVGHLRMEGREVFKHAVGMITDVIEQAFEATGTTADDLDWLVPHQANKRIIDGSAKKLNIDPEKVVITVDKHGNTSAASIPLALAVAASDGRIKKGDLVMLEAMGGGFTWGAVLLRW GT:EXON 1|1-323:0| SW:ID FABH_AGRT5 SW:DE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; EC=2.3.1.180;AltName: Full=3-oxoacyl-[acyl-carrier-protein] synthase III;AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS III; SW:GN Name=fabH; OrderedLocusNames=Atu1179; ORFNames=AGR_C_2178; SW:KW Acyltransferase; Complete proteome; Cytoplasm;Fatty acid biosynthesis; Lipid synthesis; Multifunctional enzyme;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->323|FABH_AGRT5|e-164|100.0|323/323| GO:SWS:NREP 6 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006633|"GO:fatty acid biosynthetic process"|Fatty acid biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 51->70|ttaslgeaaaraaldnaglt| SEG 282->295|saasiplalavaas| BL:PDB:NREP 1 BL:PDB:REP 8->323|2ebdB|4e-73|45.9|303/308| RP:PDB:NREP 1 RP:PDB:REP 7->323|1b65A|1e-39|10.0|301/363| RP:PFM:NREP 2 RP:PFM:REP 107->190|PF08545|2e-25|67.1|79/79|ACP_syn_III| RP:PFM:REP 235->322|PF08541|4e-22|48.9|88/90|ACP_syn_III_C| HM:PFM:NREP 3 HM:PFM:REP 235->323|PF08541|2.6e-39|58.4|89/90|ACP_syn_III_C| HM:PFM:REP 107->190|PF08545|1.3e-35|66.2|80/80|ACP_syn_III| HM:PFM:REP 50->146|PF00108|8.3e-06|27.1|96/264|Thiolase_N| GO:PFM:NREP 4 GO:PFM GO:0004315|"GO:3-oxoacyl-[acyl-carrier-protein] synthase activity"|PF08545|IPR013751| GO:PFM GO:0006633|"GO:fatty acid biosynthetic process"|PF08545|IPR013751| GO:PFM GO:0008610|"GO:lipid biosynthetic process"|PF08541|IPR013747| GO:PFM GO:0016747|"GO:transferase activity, transferring acyl groups other than amino-acyl groups"|PF08541|IPR013747| RP:SCP:NREP 2 RP:SCP:REP 8->174|1eblA1|1e-54|43.1|167/174|c.95.1.2| RP:SCP:REP 207->323|1u0mA2|6e-27|19.7|117/148|c.95.1.2| HM:SCP:REP 8->323|1tedA_|2.9e-71|35.7|305/0|c.95.1.2|1/1|Thiolase-like| OP:NHOMO 1292 OP:NHOMOORG 842 OP:PATTERN ---------------------------1---------------------------------------- 11214---------12211-11--2-111112----32111333112121111221131111112234631--------11-111111422114111--224333124141111111111111112111111121111111---3111111111111111112111111611111111111111121111-112444442253424222132212342111111111111132111111111111111121111-111111-1-2211111222211111111111111111111111111111111111111211111111111121222222212131223111-13--3111111111113111121122212222211111221111122222222222222222-33133112242222211121111112223122111122211111111111111111111111111--11111111211111111-211212111141121433333113144443221311111122211111211211113121231111111111111123221111112111122242222222224422111112221221111111111111111331-211221132333532333343223251-11111------12111111112111111-1111121111111111112111221111111111111111111211111111-1121222122221111222213443113111111111111111111111111111--44442425122221332111111111111122222232232113232222311111113--1111--------1-2-------------------------11----1---121 1-------1----1----------------------------------------------------------------------------------------------41----------------------------------------------------1-------------111A111115115-12-1----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 322 STR:RPRED 99.7 SQ:SECSTR #ccEEEGGGTccccccccTTccGGGcTTcEEEEEEEEcccccTTcccccEEEEEEEETTTTccccccEEEEEEEEEEccccccHHccHHHHHcEEcccEEEEEGGGHHHHHGHHHHHHHHHHTHHHHccccccccccEEEEEccTTccGGGccccHHHHHHHHHTccccccccccGGTTcEETTEEcEEEEEEEEEEETTEEEEEccGGGcccTTccHHHHccTTcHHHHHHHHHHTTccGHHccEEEEEEEcccccHHHHHHHHHTHHHHHHTTTccccTTcEEEEEEEEccccccGGGccccccccccccGGGHHHHHHHH PSIPRED cEEEEEEEEEEEcccccccHHHHHHHHcccHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHccccHHHccEEEEEccccccccccHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEEEHHcccccHHHccccEEEEccEEEEEEcccccccccccccEEEEEEEEccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHccccHHHccEEEEccccHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccEEEEEEEEccccEEEEEEEc //