[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fabI.1
DDBJ      :fabI         enoyl-(acyl-carrier-protein) reductase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  693/915 : Eukaryota  77/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:268 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->253 3k2eA PDBj 1e-86 60.0 %
:RPS:PDB   2->253 1dohB PDBj 3e-25 19.8 %
:RPS:SCOP  3->255 1c14A  c.2.1.2 * 2e-32 46.2 %
:HMM:SCOP  6->258 1uh5A_ c.2.1.2 * 4.6e-63 31.5 %
:RPS:PFM   21->178 PF00106 * adh_short 9e-10 32.5 %
:HMM:PFM   25->177 PF00106 * adh_short 6.9e-15 25.9 147/167  
:BLT:SWISS 1->268 FABI2_RHIME e-122 79.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85969.2 GT:GENE fabI.1 GT:PRODUCT enoyl-(acyl-carrier-protein) reductase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(157461..158267) GB:FROM 157461 GB:TO 158267 GB:DIRECTION - GB:GENE fabI GB:PRODUCT enoyl-(acyl-carrier-protein) reductase GB:PROTEIN_ID AAK85969.2 GB:DB_XREF GI:159139515 GB:GENE:GENE fabI LENGTH 268 SQ:AASEQ MNGIMQGKRGLIMGVANNHSIAWGISKALAAQGAELAFTYQGEALGKRVKPLAAELGSDFIVPCDVEDIASVDALFATIREKWGALDFVVHAIGFSDKNELKGLYANTTRENFSRTMVISCFSFTEIAKRAAELMTNGGSMLTLTYNGSQRVIPNYNVMGVAKAALEASVRYLAADYGPRDIRVNAISAGPVRTLAGAGISDARAIYAWNQKNAPLRRTADIDDIGGSALYLLSSLSRGVTGECHYVDCGYNITSTPTLEVLSKADAE GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 1->268|FABI2_RHIME|e-122|79.5|268/268| SEG 228->237|salyllssls| BL:PDB:NREP 1 BL:PDB:REP 4->253|3k2eA|1e-86|60.0|250/260| RP:PDB:NREP 1 RP:PDB:REP 2->253|1dohB|3e-25|19.8|248/271| RP:PFM:NREP 1 RP:PFM:REP 21->178|PF00106|9e-10|32.5|154/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 25->177|PF00106|6.9e-15|25.9|147/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 3->255|1c14A|2e-32|46.2|253/256|c.2.1.2| HM:SCP:REP 6->258|1uh5A_|4.6e-63|31.5|251/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1564 OP:NHOMOORG 773 OP:PATTERN ---------------------------1---1--------------------------------1--- 25414--1------44311-141127111112557523342217-211122-1111----33214124532---------2-1112221131-1--1--223113A351311111111111111122223222332111112221-22111111111111111121143511211111211111111111-512222221111112111332222111222112122222222111111111111111211111-11--11-1-1111--1111--111-------1------------------------------------1---1---1----------------1--11-----------1--------3-4422322222477652143334422222222223-24422422546256634545663343131522344432333333333233112431111111111111111111111111111113543243324544282133335556333322444378311433212234332441231113211111111113122-1--21111111121111211111112552--221212222212222222221222211211-2-1-11--1221-11211-11111--1-112111111112212-3-3332322233-33333323233333333323336111132333333333333332333333311-111111-11111111-----2222123211111121111111112224222122622223223331-2-24231111111111--------------1233422-------111-331-11-----------------------------------------1-11-121 11----1-1-----1-3-121214-33-1-----1-----------131-1223-2-31211-------------------------1-3213-1121221-11-1-12-----1-------------------------------------------2112-3-12--------1111H111312234-212111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 264 STR:RPRED 98.5 SQ:SECSTR TGGccTTcEEEETTTTcHHHHHHHHHHHHTTcEEEEEEcccHHHHHHHHHHHHHTTccEEEEEccTTcHHHHHHHHHHHHHHHccccEEEEccccccTTcccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHHcTTcEEEEEccGGGTcccccccHHHHHHHHHHHHHHHHHHHHHGGGTcEEEEEEEcccccHHHHHHGGGGcHHHHHHHccTTcccccHHHHHHHHHHHHcGGGTTccccEEEEccccccccTHHHHHccc#### DISOP:02AL 1-1,264-269| PSIPRED ccccccccEEEEEcccccccHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHccccEEEEcccccccccccccHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHcccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccccccHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccEEEEcccEEEEccccHHHHHHHHcc //