[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fabI.2
DDBJ      :fabI         enoyl-(acyl-carrier-protein) reductase
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  818/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:272 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->259 3grkB PDBj e-105 73.8 %
:RPS:PDB   1->255 1dohB PDBj 3e-32 21.5 %
:RPS:SCOP  6->259 1c14A  c.2.1.2 * 4e-40 50.4 %
:HMM:SCOP  9->261 1uh5A_ c.2.1.2 * 4.6e-68 32.7 %
:RPS:PFM   24->181 PF00106 * adh_short 5e-08 27.6 %
:HMM:PFM   25->179 PF00106 * adh_short 8.9e-14 20.8 149/167  
:BLT:SWISS 1->272 FABI1_RHIME e-131 84.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86566.1 GT:GENE fabI.2 GT:PRODUCT enoyl-(acyl-carrier-protein) reductase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(754209..755027) GB:FROM 754209 GB:TO 755027 GB:DIRECTION - GB:GENE fabI GB:PRODUCT enoyl-(acyl-carrier-protein) reductase GB:PROTEIN_ID AAK86566.1 GB:DB_XREF GI:15155730 GB:GENE:GENE fabI LENGTH 272 SQ:AASEQ MAQASGLMAGKRGLIMGVANNRSIAWGIAKACADAGAELALTWQGDALKKRVEPLAQELGAFMAGHCDVTDLETIDSVFASLEQHWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFNRTMDISVFSLAAVAKRAEPIMNDGGSIITLTYYGAEKVMPNYNVMGVAKAALEASVRYLAVDLGNRGIRVNAVSAGPIKTLAASGIGDFRYILKWNEYNAPLKRTVTIEEVGKSALYLLSDLSTAVTGEIHHVDSGYHTIGMKAVDAPDISVVKD GT:EXON 1|1-272:0| BL:SWS:NREP 1 BL:SWS:REP 1->272|FABI1_RHIME|e-131|84.2|272/272| BL:PDB:NREP 1 BL:PDB:REP 6->259|3grkB|e-105|73.8|252/252| RP:PDB:NREP 1 RP:PDB:REP 1->255|1dohB|3e-32|21.5|251/271| RP:PFM:NREP 1 RP:PFM:REP 24->181|PF00106|5e-08|27.6|152/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 25->179|PF00106|8.9e-14|20.8|149/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 6->259|1c14A|4e-40|50.4|254/256|c.2.1.2| HM:SCP:REP 9->261|1uh5A_|4.6e-68|32.7|251/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 4221 OP:NHOMOORG 1023 OP:PATTERN --1-111211211111-3--11112--2-322-1-------------1--2-1-1-11--1-222-11 5AB27--2223-2-BG988-8H229K878889FKLL9GHJ433J31221231533113114382939BA62---------31721222223312--2--439269I693A22222222222222233243322432111222225234542241211111112121365F31111211111114332212-62A55555455454555496557A4555A9667233333369322222122222221344552-111112-1-11221111222-1111-111111--111111111111111111111111-11---111-22238333222232212331233-321-23---12----1321111231-316B55522222A8IAA215A689644444444449-57865A46BIA2GCC6EAFMJLBCCA373976587886833333333487522652222222211111111111111111111115EB5267369DEHBIB68888BBFI777736H7D9II724874624657584BC2431344411111111114644161121111111121322232111222575--3222222222122222222222222333311253142-14435453544443345-11-1122112122255633637774756577-7777776767766677775BB983312656566766766665667776557213444444344441122-1---222212675222314222222232899A946354758778697856254698A22222222221112-----32-2233668551111111211-332222--------1----------------------------12-11-121262 11--1-3-1----2338467875E8D8221223212-423134---78526BJI57663655343-31141121211111256666-6-45283823235323323-342J35763-2---13-21-213C3-2-2-13-32241-2-212--121345DD72C698445136443311M11124553J4C23253232 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 272 STR:RPRED 100.0 SQ:SECSTR ccGGGGccTTcEEEETTTTcHHHHHHHHHHHHTTcEEEEEEcccHHHHHHHHHHHHHTTccEEEEEccTTcHHHHHHHHHHHHHHHccccEEEEccccccTTcccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHHcTTcEEEEEccGGGTcccccccHHHHHHHHHHHHHHHHHHHHHGGGTcEEEEEEEcccccHHHHHHGGGGcTTcTTccHHTTcccccHHHHHHHHHHHHcGGGTTccccEEEEcccccGcccccTTcTTcHHHHH DISOP:02AL 1-4, 267-268, 271-272| PSIPRED cccccccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHccEEEEEEcccccccccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHcccccEEEEEccccEEEEccccccccHHHHcc //