[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fabZ.1
DDBJ      :fabZ         (3R)-Hydroxymyristoyl-(acyl carrier protein)- Dehydratase
Swiss-Prot:FABZ_AGRT5   RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase;         Short=(3R)-hydroxymyristoyl ACP dehydrase;         EC=4.2.1.-;

Homologs  Archaea  0/68 : Bacteria  781/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->149 2gllF PDBj 6e-33 46.3 %
:RPS:PDB   11->150 3dozD PDBj 2e-30 45.7 %
:RPS:SCOP  13->149 1u1zA  d.38.1.6 * 7e-45 44.5 %
:HMM:SCOP  16->154 1mkaA_ d.38.1.2 * 2.2e-47 44.9 %
:RPS:PFM   21->142 PF07977 * FabA 2e-30 50.0 %
:HMM:PFM   21->143 PF07977 * FabA 1.5e-42 48.0 123/138  
:BLT:SWISS 1->154 FABZ_AGRT5 1e-87 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87175.2 GT:GENE fabZ.1 GT:PRODUCT (3R)-Hydroxymyristoyl-(acyl carrier protein)- Dehydratase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1377948..1378412 GB:FROM 1377948 GB:TO 1378412 GB:DIRECTION + GB:GENE fabZ GB:PRODUCT (3R)-Hydroxymyristoyl-(acyl carrier protein)- Dehydratase GB:PROTEIN_ID AAK87175.2 GB:DB_XREF GI:159140028 GB:GENE:GENE fabZ LENGTH 154 SQ:AASEQ MADETKATLGTADILEVMKLLPHRYPFLLIDKIIEIDGDSSAIGIKNVTVNEPHFTGHFPDRPIMPGVLIVEAMAQTAGAICARNQGEGGHLVYFMTIDNARFRRPVVPGDRLEIHVVKQRQRGNVFKFHCEAKVEGALVAEADVGAMMIPEGQ GT:EXON 1|1-154:0| SW:ID FABZ_AGRT5 SW:DE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase; EC=4.2.1.-; SW:GN Name=fabZ; OrderedLocusNames=Atu1383; ORFNames=AGR_C_2558; SW:KW Complete proteome; Cytoplasm; Lipid A biosynthesis; Lipid synthesis;Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->154|FABZ_AGRT5|1e-87|100.0|154/154| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0009245|"GO:lipid A biosynthetic process"|Lipid A biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 14->149|2gllF|6e-33|46.3|136/147| RP:PDB:NREP 1 RP:PDB:REP 11->150|3dozD|2e-30|45.7|140/149| RP:PFM:NREP 1 RP:PFM:REP 21->142|PF07977|2e-30|50.0|122/127|FabA| HM:PFM:NREP 1 HM:PFM:REP 21->143|PF07977|1.5e-42|48.0|123/138|FabA| RP:SCP:NREP 1 RP:SCP:REP 13->149|1u1zA|7e-45|44.5|137/142|d.38.1.6| HM:SCP:REP 16->154|1mkaA_|2.2e-47|44.9|136/0|d.38.1.2|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 912 OP:NHOMOORG 805 OP:PATTERN -------------------------------------------------------------------- 1111------------------------------------------------1------------1---1---------111111111111111111--111121111-21111111111111111111211111111111---11111111111111111111111111111111111111111111111112222222221221222121112122111211111111112111111111111111111112-222222-2-2222222222122222221111111111111111111111111111111111111111111111111111111111111111111--1211111111111111111111211111111111111111111111111111111111-22222221111122212111111122--11111111111111111111211111111111111111111111111111111111111111111111111112111111111111111121111111111-1111111111111111111111111111111-2-121111111111111211112111121-21111111111111111111111111111111111111111111111111111111111-1111111111-11111111111111111-1111111111111111111111111111111111111111111211111111-12222221222211112222211111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111--------------1-1-------------------------1111111111121 11------1---------------------------------------------------------------------------------------------------2-------------------------------------------------------------2----1111A111113212-2111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 96.1 SQ:SECSTR ######TccccccHHHHHHHccccTTcccccEEEEEETTTEEEEEEEcccccGGGGcccTTcccccHHHHHHHHHHHHHHHHHcccHHTTcEEEEEEEEEEEEcccccTTcEEEEEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEEEEEcHH DISOP:02AL 1-5,153-155| PSIPRED cccccccccccccHHHHHHHccccccEEEEEEEEEEEcccEEEEEEEccccccEEccccccccEEcHHHHHHHHHHHHHHHHHccccccccEEEEEEEccEEEccEEccccEEEEEEEEEEEEccEEEEEEEEEEccEEEEEEEEEEEEEEccc //