[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fabZ.2
DDBJ      :fabZ         (3R)-Hydroxymyristoyl-(acyl carrier protein)- Dehydratase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  513/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->125 3d6xA PDBj 6e-14 40.2 %
:RPS:PDB   6->126 3dozD PDBj 5e-14 27.5 %
:RPS:SCOP  6->124 1u1zA  d.38.1.6 * 9e-26 30.3 %
:HMM:SCOP  6->138 1mkaA_ d.38.1.2 * 6e-25 36.2 %
:RPS:PFM   6->121 PF07977 * FabA 7e-13 33.0 %
:HMM:PFM   4->123 PF07977 * FabA 2.2e-22 28.3 120/138  
:BLT:SWISS 6->124 FABZ_CHLAD 5e-17 33.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87377.1 GT:GENE fabZ.2 GT:PRODUCT (3R)-Hydroxymyristoyl-(acyl carrier protein)- Dehydratase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1581007..1581486) GB:FROM 1581007 GB:TO 1581486 GB:DIRECTION - GB:GENE fabZ GB:PRODUCT (3R)-Hydroxymyristoyl-(acyl carrier protein)- Dehydratase GB:PROTEIN_ID AAK87377.1 GB:DB_XREF GI:15156684 GB:GENE:GENE fabZ LENGTH 159 SQ:AASEQ MLLEYFQMIDKVESVDMATRTLKAQSVVPDHSPVFEGHFPGMPLVPGVLLIETMAQASGMMVLAFSDFASMPFLMSVDGAKMRTFVEPGAVLDIEAVLEHDGSGFAVTKAKITSAGKKVCDAQLKLRTMPFSEIPLGPIVKKRAEEVGLMAAIAADAQK GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 6->124|FABZ_CHLAD|5e-17|33.1|118/144| BL:PDB:NREP 1 BL:PDB:REP 6->125|3d6xA|6e-14|40.2|112/130| RP:PDB:NREP 1 RP:PDB:REP 6->126|3dozD|5e-14|27.5|120/149| RP:PFM:NREP 1 RP:PFM:REP 6->121|PF07977|7e-13|33.0|115/127|FabA| HM:PFM:NREP 1 HM:PFM:REP 4->123|PF07977|2.2e-22|28.3|120/138|FabA| RP:SCP:NREP 1 RP:SCP:REP 6->124|1u1zA|9e-26|30.3|119/142|d.38.1.6| HM:SCP:REP 6->138|1mkaA_|6e-25|36.2|130/0|d.38.1.2|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 548 OP:NHOMOORG 521 OP:PATTERN -------------------------------------------------------------------- 1-1----------------------------------------------------------------------------11-----11111111--1-------1-11--1111111---111111111211111111111---1-1------1111111111---1----11111111111111111---1-111111111-111111--1111111--111--11111111-------------------12-121122-1-112211121111222--------------------------------------------1111--------1-1-1111111111--1-111--111-111-11111111--111--1111-111111111111------------11111111--1122211111111122--1111111111111111111111-11--11111----1--11111111111111111-111111----------------------------111111-----111-1-------1---11------------1------1-1-1---1111-11112----11-1111111111111---111--11-11--11111-1-1-111111111111111111111-111--------11111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-111111-----1-11111-11111111--1------------11111-11111111111111111111111111111111111111111111111111111--------------1-1--------------------------111--1-1-111 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1A111---------11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 88.7 SQ:SECSTR #####cccccEEEEEETTTTEEEEEEEcccccGGGGcccTTcccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEcccccTTcEEEEEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEEEEEHHHHHHHHHHHHHHTc############# DISOP:02AL 156-159| PSIPRED ccccccEEEEEEEEEEccccEEEEEEEccccccEEcccccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEEccEEEccEEccccEEEEEEEEEEEcccEEEEEEEEEEccEEEEEEEEEEEEEcccccccHHHHHHHHHHcccHHHHHHcccc //