[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fbpA
DDBJ      :fbpA         ABC transporter, substrate binding protein (iron)
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  333/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:338 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->337 1y9uA PDBj e-118 66.7 %
:RPS:PDB   25->335 1d9yA PDBj 1e-33 24.8 %
:RPS:SCOP  23->337 1q35A  c.94.1.1 * 3e-96 48.1 %
:HMM:SCOP  25->334 1xvyA_ c.94.1.1 * 1.3e-74 37.0 %
:HMM:PFM   36->283 PF01547 * SBP_bac_1 6.4e-16 22.8 241/314  
:BLT:SWISS 25->336 IDIA_SYNP6 2e-58 41.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86222.2 GT:GENE fbpA GT:PRODUCT ABC transporter, substrate binding protein (iron) GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 403461..404477 GB:FROM 403461 GB:TO 404477 GB:DIRECTION + GB:GENE fbpA GB:PRODUCT ABC transporter, substrate binding protein (iron) GB:PROTEIN_ID AAK86222.2 GB:DB_XREF GI:159139622 GB:GENE:GENE fbpA LENGTH 338 SQ:AASEQ MTKFTRFALLASTVAFAAGTVSAAELNIYTTREPGLIQPLLESFTASSGVKVNTVFLKDGLAERVLSEGASSPADVLMTVDAGNLVDLAEKGVTQAVESETLTKAVPAELRDAKGHWFALSMRARVLYAAKDLDLASFNYEDLADAKWKGKVCIRAGQHPYNTALFADYIAHYGAADTEKWLAGVKENLARKAGGGDRDVAKDILGGICDIGIANSYYVGLMRSGKGGEEQVKWGDAIKVVLPTFKNGGTQVNISGAAVAKNAPNKAEAVKLLEYLVSDEAQKIYAEANYEYPVKQGAALNEIVASFGTLKIDNKPLTEIVSHRKQASELVDKVGFDK GT:EXON 1|1-338:0| BL:SWS:NREP 1 BL:SWS:REP 25->336|IDIA_SYNP6|2e-58|41.6|310/357| BL:PDB:NREP 1 BL:PDB:REP 25->337|1y9uA|e-118|66.7|312/314| RP:PDB:NREP 1 RP:PDB:REP 25->335|1d9yA|1e-33|24.8|302/309| HM:PFM:NREP 1 HM:PFM:REP 36->283|PF01547|6.4e-16|22.8|241/314|SBP_bac_1| RP:SCP:NREP 1 RP:SCP:REP 23->337|1q35A|3e-96|48.1|310/317|c.94.1.1| HM:SCP:REP 25->334|1xvyA_|1.3e-74|37.0|300/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 377 OP:NHOMOORG 338 OP:PATTERN ------------------------1--11--1------------------------------------ ----1----------------2---1------1112--32---1--------111-1---1-1-------------------1-----------------------------------------------------11111---11111122111221111122311-1-11111111111111--11------11111111-11111111----111------1------2---------------------------------1----------------------------------------------------------1------------------11--------------1---1----------------------------11111111111111112-11111111111-12211111111111-111111111111---------------11111111111---------------11111-----11111111111-1111111-1111112-21-1------111111111111111---1111111111-111211--1-1---1-----------1-----1---1--1-111111-------------1--111-1-1111112111-1111111111111----111--------111---------------------------------1122-------------------1---------111111111111---1----------1112----1--11111111-------1121122212332-22221111----------11111111111121--------------11--------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 337 STR:RPRED 99.7 SQ:SECSTR ccccHHHccccEEccccEEEEETTcEEEEEcccHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHGGGccccEEEEccHHHHHHHHHTTccccccTTHHHHTccTTccccTcccEEEEEEEEEEEEETTTccGGccGGGGccGGGTTTEEEcTTcHHHHHHHHHEHHHHHcHHHHHHHHHHHHHHcEEcccHHHHHHHHHHHTTcccEEEEETHHHHHHHHHHcccHHTGGGccEEEEcccTTcGGGcEEEEEEEEcTTcccHHHHHHHHHHHHcHHHHHHHHHHcccEEccTTcccccccccHHHHTccccccccHHHHHHHHHHHHHHHTcT# DISOP:02AL 1-1,338-339| PSIPRED cHHHHHHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHccccccEEEEccHHHHHHHHHccccccccHHHHHHcccHHHHcccccEEEEEEEEEEEEEccccccccccHHHHHcHHHcccEEEEccccccHHHHHHHHHHHccHHHHHHHHHHHHHHccEEcccccHHHHHHHHcccccEEEEccHHHHHHHHccccHHHHHcccccEEEEcccccccEEEEEEEEEEEcccccHHHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHcccccccccccHHHHHHHHHHHHHHHHHccccc //