[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : flaA
DDBJ      :flaA         flagella associated protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  202/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
e.32.1
:306 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->141 1ucuA PDBj 2e-07 25.4 %
:RPS:PDB   80->154 2c5jA PDBj 1e-04 4.2 %
:HMM:SCOP  1->306 1ucuA_ e.32.1.1 * 1.1e-58 31.5 %
:RPS:PFM   6->130 PF00669 * Flagellin_N 7e-11 34.4 %
:HMM:PFM   4->134 PF00669 * Flagellin_N 4.5e-31 31.3 131/139  
:HMM:PFM   222->305 PF00700 * Flagellin_C 2e-20 29.8 84/86  
:BLT:SWISS 1->181,205->306 FLAA2_RHIME 3e-64 69.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86357.1 GT:GENE flaA GT:PRODUCT flagella associated protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(534488..535408) GB:FROM 534488 GB:TO 535408 GB:DIRECTION - GB:GENE flaA GB:PRODUCT flagella associated protein GB:PROTEIN_ID AAK86357.1 GB:DB_XREF GI:15155481 GB:GENE:GENE flaA LENGTH 306 SQ:AASEQ MASILTNNNAMAALSTLRSIASDLSTTQDRISSGLKVGSASDNAAYWSIATTMRSDNKALGAVSDALGMGAAKVDTASAGMDAAIKVVTDIKAKVVAAKEQGVDKTKVQEEVSQLLDQLKSIGTSASFNGENWLVSSANATKTVVSGFVRDAGGTVSVKTTDYALDANSMLYTEGTPGTIDANSGILNATGATTTVGAKTYTQISVLDMNVGTDDLDNALYSVETALTKMTSAGAKLGSLSARIDLQSGFADKLSDTIEKGVGRLVDADMNEESTKLKALQTQQQLAIQALSIANSDSQNILSLFR GT:EXON 1|1-306:0| BL:SWS:NREP 1 BL:SWS:REP 1->181,205->306|FLAA2_RHIME|3e-64|69.1|283/395| SEG 189->202|atgatttvgaktyt| SEG 274->294|stklkalqtqqqlaiqalsia| BL:PDB:NREP 1 BL:PDB:REP 24->141|1ucuA|2e-07|25.4|118/494| RP:PDB:NREP 1 RP:PDB:REP 80->154|2c5jA|1e-04|4.2|71/82| RP:PFM:NREP 1 RP:PFM:REP 6->130|PF00669|7e-11|34.4|125/137|Flagellin_N| HM:PFM:NREP 2 HM:PFM:REP 4->134|PF00669|4.5e-31|31.3|131/139|Flagellin_N| HM:PFM:REP 222->305|PF00700|2e-20|29.8|84/86|Flagellin_C| GO:PFM:NREP 3 GO:PFM GO:0001539|"GO:ciliary or flagellar motility"|PF00669|IPR001492| GO:PFM GO:0005198|"GO:structural molecule activity"|PF00669|IPR001492| GO:PFM GO:0009420|"GO:bacterial-type flagellum filament"|PF00669|IPR001492| HM:SCP:REP 1->306|1ucuA_|1.1e-58|31.5|302/0|e.32.1.1|1/1|Phase 1 flagellin| OP:NHOMO 394 OP:NHOMOORG 203 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------11--------------------2-------------------------------------------------------------------------------------------11-1111111-113111-1----11-----------------------------------------------------------------------------------------------------1-222-21--1----------11---2-----11--1-------------66721----112------1--111111111111-21421-1122-15447674777443-6151111-11161---------112--22-------------------------------12-1-111-1---11------------1-1------------1212----1-2--11---2--------1---31--1-22-------1-1--------21-2-------1-222212232222222-12-----1--1-2----1-44--1-1212--2121----1---------211-21----------1--1--1----1--1---------11--------------------------------------1-----------------2-2-------------------------11----111-------111----------45513333355334-1--------------7---------------21--------------------------1------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 45.1 SQ:SECSTR #######################HHHHHHHHHTcccTTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcTTcHHHHHHHHHHHHHHHHcccEEEE################################################################################################################################################# DISOP:02AL 17-35, 59-61| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccEEEEEEEcccccccEEEEEEEHHHHHHHHEEEEEcccccccccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //