[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : flaF
DDBJ      :flaF         FLAF protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:RPS:PFM   1->113 PF07309 * FlaF 6e-15 37.5 %
:HMM:PFM   1->113 PF07309 * FlaF 2.2e-35 33.0 112/113  
:BLT:SWISS 45->113 FLAF_CAUCR 3e-10 35.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86388.1 GT:GENE flaF GT:PRODUCT FLAF protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 562858..563202 GB:FROM 562858 GB:TO 563202 GB:DIRECTION + GB:GENE flaF GB:PRODUCT FLAF protein GB:PROTEIN_ID AAK86388.1 GB:DB_XREF GI:15155518 GB:GENE:GENE flaF LENGTH 114 SQ:AASEQ MYQFSYAEIMEDGVANAKDRERQALTKSIDLLVEARDSSSQRHSIEALFYTRRVWIRFIEDLKQPDNQLAMELRANLISIAIWILKECELIRKRQSTNFQGIIDVTTIIRDGLK GT:EXON 1|1-114:0| BL:SWS:NREP 1 BL:SWS:REP 45->113|FLAF_CAUCR|3e-10|35.3|68/102| RP:PFM:NREP 1 RP:PFM:REP 1->113|PF07309|6e-15|37.5|112/115|FlaF| HM:PFM:NREP 1 HM:PFM:REP 1->113|PF07309|2.2e-35|33.0|112/113|FlaF| OP:NHOMO 39 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111------1--111111111111-11-11-1111-11111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcc //