[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : flbT
DDBJ      :flbT         FlbT post-transcriptional regulator of flagellin
Swiss-Prot:FLBT_AGRT5   RecName: Full=Probable flagellum biosynthesis repressor protein flbT;

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:149 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->128 PF07378 * FlbT 1e-24 49.2 %
:HMM:PFM   5->128 PF07378 * FlbT 2.3e-44 41.1 124/126  
:BLT:SWISS 1->149 FLBT_AGRT5 7e-81 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86389.1 GT:GENE flbT GT:PRODUCT FlbT post-transcriptional regulator of flagellin GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 563199..563648 GB:FROM 563199 GB:TO 563648 GB:DIRECTION + GB:GENE flbT GB:PRODUCT FlbT post-transcriptional regulator of flagellin GB:PROTEIN_ID AAK86389.1 GB:DB_XREF GI:15155519 GB:GENE:GENE flbT LENGTH 149 SQ:AASEQ MKSTLRISLKSGEKIFINGAVLRVDRKVALEFLNDVTFLLENHVLQPDQATTPLRQLYFIAQMILINPEGREQSTNMFRKSVSMLLNCFQHDEILAELKRIDGLVASGKAFEALKAIRGLYTIEEKILSNQEMTPATIEQIRKEIAPWR GT:EXON 1|1-149:0| SW:ID FLBT_AGRT5 SW:DE RecName: Full=Probable flagellum biosynthesis repressor protein flbT; SW:GN Name=flbT; OrderedLocusNames=Atu0578; ORFNames=AGR_C_1018; SW:KW Bacterial flagellum biogenesis; Complete proteome; Repressor;RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->149|FLBT_AGRT5|7e-81|100.0|149/149| GO:SWS:NREP 2 GO:SWS GO:0043064|"GO:flagellum organization"|Bacterial flagellum biogenesis| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| RP:PFM:NREP 1 RP:PFM:REP 5->128|PF07378|1e-24|49.2|124/126|FlbT| HM:PFM:NREP 1 HM:PFM:REP 5->128|PF07378|2.3e-44|41.1|124/126|FlbT| GO:PFM:NREP 3 GO:PFM GO:0006402|"GO:mRNA catabolic process"|PF07378|IPR009967| GO:PFM GO:0045718|"GO:negative regulation of flagellum assembly"|PF07378|IPR009967| GO:PFM GO:0048027|"GO:mRNA 5'-UTR binding"|PF07378|IPR009967| OP:NHOMO 52 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111----111------1--111111111111-11111-1111-11111111111111-1---1---------------------11--------------------------------------------------------------------------------------------------------------------------111-----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccEEEEEccccEEEEccEEEEEcccEEEEEEccccHHHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccc //