[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : flgA
DDBJ      :flgA         flagellar protein FLGA precursor
Swiss-Prot:FLGA_AGRT5   RecName: Full=Flagellar protein flgA;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  49/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.85.1
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->160 3frnA PDBj 3e-04 29.4 %
:RPS:PDB   42->100 1ameA PDBj 6e-06 16.1 %
:RPS:SCOP  42->100 1vliA1  b.85.1.1 * 1e-08 11.9 %
:HMM:PFM   39->97 PF08666 * SAF 1.4e-07 19.0 58/63  
:BLT:SWISS 1->162 FLGA_AGRT5 2e-77 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86363.2 GT:GENE flgA GT:PRODUCT flagellar protein FLGA precursor GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(539408..539896) GB:FROM 539408 GB:TO 539896 GB:DIRECTION - GB:GENE flgA GB:PRODUCT flagellar protein FLGA precursor GB:PROTEIN_ID AAK86363.2 GB:DB_XREF GI:159139677 GB:GENE:GENE flgA LENGTH 162 SQ:AASEQ MRFGRNNSSCRTALVRMCLASAFSLGALAPALAQAPMALVPVRTIYPGEAISPEQVKSVEVTNPNISAGYASDISEVEGMISKQTLLPGRTIPIAALREPSLVVRGTSVKLVFHIGNMTLMASGTPMSDGSLGEVVRVRNIDSGVMVSGTVMKDGTIQVMAK GT:EXON 1|1-162:0| SW:ID FLGA_AGRT5 SW:DE RecName: Full=Flagellar protein flgA;Flags: Precursor; SW:GN Name=flgA; OrderedLocusNames=Atu0551; ORFNames=AGR_C_971; SW:KW Bacterial flagellum biogenesis; Complete proteome; Periplasm; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->162|FLGA_AGRT5|2e-77|100.0|162/162| GO:SWS:NREP 2 GO:SWS GO:0043064|"GO:flagellum organization"|Bacterial flagellum biogenesis| GO:SWS GO:0042597|"GO:periplasmic space"|Periplasm| SEG 27->41|alapalaqapmalvp| BL:PDB:NREP 1 BL:PDB:REP 43->160|3frnA|3e-04|29.4|109/258| RP:PDB:NREP 1 RP:PDB:REP 42->100|1ameA|6e-06|16.1|56/66| HM:PFM:NREP 1 HM:PFM:REP 39->97|PF08666|1.4e-07|19.0|58/63|SAF| RP:SCP:NREP 1 RP:SCP:REP 42->100|1vliA1|1e-08|11.9|59/72|b.85.1.1| OP:NHOMO 49 OP:NHOMOORG 49 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111------1--111111111111-11111-1111-11111111111111------11-1--11--------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 67.9 SQ:SECSTR #########################################cccccTTccccGGGEEEEcccccccccccGGGHHHHTTcEEcccccTTccccGGGEETcccccTTcEEEEE#######ccEEEEEcccccTTcEEEEEc##cccEEEEEEETTTEEEEc## DISOP:02AL 1-7,162-163| PSIPRED ccccccccEEEcHHHHEEcccccEEEEEEEEEEEEEEEEEEEccccccccccHHHEEEEEEEHHHcccHHcccHHHHccHHEEcccccccEEcHHHcccccEEccccEEEEEEEcccEEEEEEEEEccccccccEEEEEEcccccEEEEEEEEccEEEEEEc //