[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : flgD
DDBJ      :flgD         hook formation protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  157/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.41.1
:157 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  87->129 1pm3A  b.41.1.2 * 7e-05 27.9 %
:RPS:PFM   29->101 PF03963 * FlgD 2e-10 50.7 %
:HMM:PFM   7->114 PF03963 * FlgD 2.6e-31 34.9 106/142  
:BLT:SWISS 25->127 YLXG_BACSU 5e-13 36.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86390.1 GT:GENE flgD GT:PRODUCT hook formation protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 563639..564112 GB:FROM 563639 GB:TO 564112 GB:DIRECTION + GB:GENE flgD GB:PRODUCT hook formation protein GB:PROTEIN_ID AAK86390.1 GB:DB_XREF GI:15155520 GB:GENE:GENE flgD LENGTH 157 SQ:AASEQ MAVDAVNSAAANPWANAGASSSDKNAASLNYDSFLKLLIAQMKNQDPTSPMDAGQQMSQLASFSQVEQTIKTNTHLKSMLQAEALTRASDLVGKTVMSADDKVTGVVKEVQVFSDGIVAVTEAGDKVLLQAGVVFSNGPITTKSDETTADSNNSAGS GT:EXON 1|1-157:0| BL:SWS:NREP 1 BL:SWS:REP 25->127|YLXG_BACSU|5e-13|36.9|103/140| SEG 5->22|avnsaaanpwanagasss| RP:PFM:NREP 1 RP:PFM:REP 29->101|PF03963|2e-10|50.7|73/141|FlgD| HM:PFM:NREP 1 HM:PFM:REP 7->114|PF03963|2.6e-31|34.9|106/142|FlgD| RP:SCP:NREP 1 RP:SCP:REP 87->129|1pm3A|7e-05|27.9|43/69|b.41.1.2| OP:NHOMO 159 OP:NHOMOORG 157 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------11---------------11--11---111-11-111111-1-------------------------------------------------------------------------------------------1-1-------------------------11-1-1111-1-1--------111---11----111------1--111111111111-11111-1111111111111111111--1--1-------1-------------121-----------------------------------1-----------1111--1-111111----1----11----------1-----1-1---------------11--------2111-111-1-1-----------1-----------------------------------------------1--1-11-----1---------1-1---1111111111-1111-111-1111--1----------------------------1111111-----------------------------1----------------------------111111-----------1-----------------------------------------1-----------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 3-4, 7-32, 70-71, 147-157| PSIPRED ccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccEEEEEEEccEEccccEEEEEccccEEEEEEEEEEccccEEEcccHHHHHccccccc //