[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : flgE
DDBJ      :flgE         flagellar hook protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  484/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.152.1
:425 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   82->385 1wlgA PDBj 1e-20 26.8 %
:RPS:PDB   327->418 3e66A PDBj 9e-15 12.0 %
:RPS:SCOP  82->385 1wlgA  b.152.1.1 * 3e-51 29.4 %
:HMM:SCOP  80->385 1wlgA_ b.152.1.1 * 2.8e-65 33.6 %
:RPS:PFM   193->296 PF07559 * FlaE 1e-04 35.9 %
:RPS:PFM   385->423 PF06429 * DUF1078 2e-06 41.0 %
:HMM:PFM   385->423 PF06429 * DUF1078 4.2e-16 48.7 39/39  
:HMM:PFM   186->305 PF07559 * FlaE 2.7e-16 23.5 115/130  
:HMM:PFM   7->37 PF00460 * Flg_bb_rod 3.4e-14 58.1 31/31  
:BLT:SWISS 1->425 FLGE_RHIME 1e-93 49.4 %
:PROS 13->33|PS00588|FLAGELLA_BB_ROD
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86385.1 GT:GENE flgE GT:PRODUCT flagellar hook protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 558938..560215 GB:FROM 558938 GB:TO 560215 GB:DIRECTION + GB:GENE flgE GB:PRODUCT flagellar hook protein GB:PROTEIN_ID AAK86385.1 GB:DB_XREF GI:15155515 GB:GENE:GENE flgE LENGTH 425 SQ:AASEQ MSIFGTMRTGVSGMNAQANKLGTVGDNIANASTTGYKRASTSFSSLVLPSSSGSYASGGVQSNVRYSISEQGNLSYTTSSTDLAIQGNGFFVVQDGSGTPYLTRAGSFQKNSEGYLENAAGFQLMGYPYGSNPPAAVVNGFTGLEAINVNNFGLTASPSTQGSFPANLNRDDKAATAPLPSGNSATAAFGNKTSLTAFDSGGAKVLYDFYYTKTGDNTWEVAVYRQDQSTNGGFPYTATPAANLVQTKVDLEFDPATNKLTTASPKSITIDDQVSGVPQAINIDLSQMTQFSAKFTPGTAVLNGNGPSQIKDVEIGKDGLVTAVYQDGGRRNIYQLALATVPSVDNLTPQNGNVYLPSNDSGVVTIGFPQSGSFGYIQKGALEGSNVDIASELTDMIESQRIYTANSKVFQTGSDLMDVLINLKR GT:EXON 1|1-425:0| BL:SWS:NREP 1 BL:SWS:REP 1->425|FLGE_RHIME|1e-93|49.4|405/406| PROS 13->33|PS00588|FLAGELLA_BB_ROD|PDOC00508| SEG 40->62|stsfsslvlpsssgsyasggvqs| BL:PDB:NREP 1 BL:PDB:REP 82->385|1wlgA|1e-20|26.8|287/293| RP:PDB:NREP 1 RP:PDB:REP 327->418|3e66A|9e-15|12.0|92/255| RP:PFM:NREP 2 RP:PFM:REP 193->296|PF07559|1e-04|35.9|103/129|FlaE| RP:PFM:REP 385->423|PF06429|2e-06|41.0|39/39|DUF1078| HM:PFM:NREP 3 HM:PFM:REP 385->423|PF06429|4.2e-16|48.7|39/39|DUF1078| HM:PFM:REP 186->305|PF07559|2.7e-16|23.5|115/130|FlaE| HM:PFM:REP 7->37|PF00460|3.4e-14|58.1|31/31|Flg_bb_rod| GO:PFM:NREP 2 GO:PFM GO:0030694|"GO:bacterial-type flagellum basal body, rod"|PF07559|IPR011491| GO:PFM GO:0019861|"GO:flagellum"|PF06429|IPR010930| RP:SCP:NREP 1 RP:SCP:REP 82->385|1wlgA|3e-51|29.4|289/293|b.152.1.1| HM:SCP:REP 80->385|1wlgA_|2.8e-65|33.6|292/0|b.152.1.1|1/1|Flagellar hook protein flgE| OP:NHOMO 795 OP:NHOMOORG 485 OP:PATTERN -------------------------------------------------------------------- 1121------------------------------------1---1---1--1-1--------1-1------------------11111--------------------2------------------------------------1---------------------------------------------112111111111111111111112111111112111111111------------------------------------------------------------------------------------------11221111111121211111---111--1111-221311221122211--21111121----224131112412411111211111-3333313422222223322333213-1123113333221--------1112-334--------------------------------122221222333422222222322224243222222--211231111--232111122222-------112-21111-21233353343-11-2111111-1--1-2113-2222213333333331322---23-222222212212121322232233321---221111-11132222111111111111-1311311-11113111111---2221211111111111111111111111111122222222221---------1111--312-------------------------2211111111311111222---------2222322222332222211111112------221111112221121211--------------------------2-22222122-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 320 STR:RPRED 75.3 SQ:SECSTR #################################################################################EcccccccEEEEEcTTccEEEEcccEEEEcTTccEEcTTccEEEEEEccTTTT##cccTTcccEEccccccccccccccEEEEEEEEETTc#cccccccccTTcTTcccEEEEEEEEcTTccEEEEEEEEEEEETTEEEEEEEETTcTTccccccccEEEEccEEEccEEEEEccccTTccccEEEEEcTTcEEEcccccEEEEEEEcccc####cccEE##########EEEEcTTcEEEEEETTTTGGGGGccccEEEEEcTTccEEEEEEcTTccEEEEEEcEEEEcGGGTTTcccHHHHHHHHHHHHHHHHHHHccGGGcccEEEEccGGGHH####### DISOP:02AL 3-4, 49-58, 143-162| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcEEEEcccEEEEccEEEHHHcccccccccccccEEEccEEEEccccccEEccccEEEEEEccEEEEEEcccccEEEEEEEEEEEccccEEEcccccEEEcccccccccccEEEcccccEEEEcccccccccccccEEEEEEEEccccccccccccccccccccEEEEEEEEEEccccEEEEEEEEEEccccEEEEEEEEcccccccccEEEcccccccccccEEEEEcccccEEEcccccEEEEcccccccccEEEEEEcccccccccccccEEEccccccccEEEEEEccccEEEEEEccccEEEEEEEEEEEEccccccEEccccEEEEcccccccEEcccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //