[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : flgG
DDBJ      :flgG         flagellar basal-body rod protein
Swiss-Prot:FLGG_AGRT5   RecName: Full=Flagellar basal-body rod protein flgG;AltName: Full=Distal rod protein;

Homologs  Archaea  0/68 : Bacteria  488/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.152.1
:262 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   143->222 1wlgA PDBj 7e-09 35.4 %
:RPS:PDB   163->253 3e66A PDBj 6e-20 13.2 %
:RPS:SCOP  139->222 1wlgA  b.152.1.1 * 1e-19 34.9 %
:HMM:SCOP  92->222 1wlgA_ b.152.1.1 * 1.5e-35 40.8 %
:RPS:PFM   222->253 PF06429 * DUF1078 6e-06 71.9 %
:HMM:PFM   222->254 PF06429 * DUF1078 5.1e-19 69.7 33/39  
:HMM:PFM   5->34 PF00460 * Flg_bb_rod 1e-15 63.3 30/31  
:HMM:PFM   53->88 PF10162 * G8 0.00048 25.0 36/125  
:BLT:SWISS 1->262 FLGG_AGRT5 e-141 100.0 %
:PROS 10->30|PS00588|FLAGELLA_BB_ROD
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86364.1 GT:GENE flgG GT:PRODUCT flagellar basal-body rod protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(539917..540705) GB:FROM 539917 GB:TO 540705 GB:DIRECTION - GB:GENE flgG GB:PRODUCT flagellar basal-body rod protein GB:PROTEIN_ID AAK86364.1 GB:DB_XREF GI:15155490 GB:GENE:GENE flgG LENGTH 262 SQ:AASEQ MRALAIAATGMDAQQTNLEVIANNIANINTTGYKRARAEFTDLLYQTERMQGVPNRANQAIVPEGANIGLGVQTSAVRNIHTQGNLIETGNKLDVAIIGQGWFQIEAADGSTLYSRAGAFNKNADGNLVTVDGYNVIPNINIPTDAQDITITRTGQVTARIGNAADFTQLGQLTIANFANEAGLKPLGDNLFSQTPASGAPVVGVPDDPSYGYVKQSYLEGSNVDAVKEITDLITAQRAYEMNSKVITTADEMASIVSKNLK GT:EXON 1|1-262:0| SW:ID FLGG_AGRT5 SW:DE RecName: Full=Flagellar basal-body rod protein flgG;AltName: Full=Distal rod protein; SW:GN Name=flgG; OrderedLocusNames=Atu0552; ORFNames=AGR_C_972; SW:KW Bacterial flagellum; Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->262|FLGG_AGRT5|e-141|100.0|262/262| GO:SWS:NREP 1 GO:SWS GO:0009288|"GO:bacterial-type flagellum"|Bacterial flagellum| PROS 10->30|PS00588|FLAGELLA_BB_ROD|PDOC00508| SEG 21->29|iannianin| BL:PDB:NREP 1 BL:PDB:REP 143->222|1wlgA|7e-09|35.4|79/293| RP:PDB:NREP 1 RP:PDB:REP 163->253|3e66A|6e-20|13.2|91/255| RP:PFM:NREP 1 RP:PFM:REP 222->253|PF06429|6e-06|71.9|32/39|DUF1078| HM:PFM:NREP 3 HM:PFM:REP 222->254|PF06429|5.1e-19|69.7|33/39|DUF1078| HM:PFM:REP 5->34|PF00460|1e-15|63.3|30/31|Flg_bb_rod| HM:PFM:REP 53->88|PF10162|0.00048|25.0|36/125|G8| GO:PFM:NREP 1 GO:PFM GO:0019861|"GO:flagellum"|PF06429|IPR010930| RP:SCP:NREP 1 RP:SCP:REP 139->222|1wlgA|1e-19|34.9|83/293|b.152.1.1| HM:SCP:REP 92->222|1wlgA_|1.5e-35|40.8|130/0|b.152.1.1|1/1|Flagellar hook protein flgE| OP:NHOMO 1469 OP:NHOMOORG 491 OP:PATTERN -------------------------------------------------------------------- 3331------------------------------------1---1---1--1-1--------1-1------------------22333--------------------3------------------------------------3---------------------------------------------133111111121211111323323121233333211111123------------------------------------------------------------------------------------------32333333333343433333---333--23331223333332333331--23233322----335243242632511311122223-6646614433323333333333334-3232225555222--------1222-364--------------------------------332332333444733333333423336364333333--533333333--363333333333-------333-33332-2344446445423223333322-2--3-3444-4444444444444444443---36-232332333633373633363355653---323221-11152333333333333333-3533533233335233333---3333333333333333333333321223233344454444453---------3333--533-------------------------3333332332533333434---------2333633333662333333333336------333333333333333333--------------------------3-33333233-3- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------3-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 202 STR:RPRED 77.1 SQ:SECSTR ##############################################cccccccccccccccTTTTTcccccccHHHHHT#####TcccccccEEEEEEETTccHHHHHHHHHHHHcTTcccTTTTTccEEEEccEEcTTTcccccEEEEEEcTTcEEEEEETcTTTGGGGGccccEEEEEcTTccEEEEEEcTTccEEEEEEcEEEEcGGGTTTcccHHHHHHHHHHHHHHHHHHHccGGGcccEEEEccGGG######### DISOP:02AL 47-62| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEEcccccEEEcccccEEEEEccEEEEEEcccccEEEccccccccccccEEEcccccEEEEcccccccccEEEEccccEEEEEEccccccEEEEEEEEEEcccHHHcEEccccEEEEccccccccccccccccccEEEEcEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //