[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fliE
DDBJ      :fliE         flagellar hook-basal body complex protein
Swiss-Prot:FLIE_AGRT5   RecName: Full=Flagellar hook-basal body complex protein fliE;

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   20->112 PF02049 * FliE 6e-04 30.1 %
:HMM:PFM   29->112 PF02049 * FliE 2.8e-21 33.3 84/97  
:BLT:SWISS 1->112 FLIE_AGRT5 7e-57 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86365.1 GT:GENE fliE GT:PRODUCT flagellar hook-basal body complex protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(540724..541062) GB:FROM 540724 GB:TO 541062 GB:DIRECTION - GB:GENE fliE GB:PRODUCT flagellar hook-basal body complex protein GB:PROTEIN_ID AAK86365.1 GB:DB_XREF GI:15155491 GB:GENE:GENE fliE LENGTH 112 SQ:AASEQ MIDGIKQLGSLSLTRGASGVSSLTESLFGGEQQSTPAQQTGASFASVLGNVSMDAMNNLKKAEVASFEGIQGKANTREVVDAVLSAEQSLQTAIALRDKIVSAYLDITKMQI GT:EXON 1|1-112:0| SW:ID FLIE_AGRT5 SW:DE RecName: Full=Flagellar hook-basal body complex protein fliE; SW:GN Name=fliE; OrderedLocusNames=Atu0553; ORFNames=AGR_C_974; SW:KW Bacterial flagellum; Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->112|FLIE_AGRT5|7e-57|100.0|112/112| GO:SWS:NREP 1 GO:SWS GO:0009288|"GO:bacterial-type flagellum"|Bacterial flagellum| RP:PFM:NREP 1 RP:PFM:REP 20->112|PF02049|6e-04|30.1|93/98|FliE| HM:PFM:NREP 1 HM:PFM:REP 29->112|PF02049|2.8e-21|33.3|84/97|FliE| GO:PFM:NREP 4 GO:PFM GO:0001539|"GO:ciliary or flagellar motility"|PF02049|IPR001624| GO:PFM GO:0003774|"GO:motor activity"|PF02049|IPR001624| GO:PFM GO:0005198|"GO:structural molecule activity"|PF02049|IPR001624| GO:PFM GO:0009288|"GO:bacterial-type flagellum"|PF02049|IPR001624| OP:NHOMO 43 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111------1--111111111111-11111-1111-11111111111111----------------------------21------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 20-46, 53-68| PSIPRED ccHHHHHHHHHHHHHHHHHccHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //