[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fliG
DDBJ      :fliG         flagellar motor switch protein FliG
Swiss-Prot:FLIG_AGRT5   RecName: Full=Flagellar motor switch protein fliG;

Homologs  Archaea  0/68 : Bacteria  441/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.118.14
:347 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   126->333 1lkvX PDBj 4e-23 28.0 %
:RPS:PDB   66->187 2bj9A PDBj 4e-10 11.0 %
:RPS:SCOP  126->335 1lkvX  a.118.14.1 * 2e-43 27.8 %
:HMM:SCOP  6->107 1lkvX_ a.118.14.1 * 1.3e-10 25.7 %
:HMM:SCOP  126->337 1lkvX_ a.118.14.1 * 1.4e-44 32.2 %
:RPS:PFM   235->335 PF01706 * FliG_C 2e-09 36.0 %
:HMM:PFM   226->336 PF01706 * FliG_C 2e-27 32.7 110/110  
:HMM:PFM   138->238 PF03448 * MgtE_N 4.2e-07 24.7 93/102  
:BLT:SWISS 1->347 FLIG_AGRT5 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86375.1 GT:GENE fliG GT:PRODUCT flagellar motor switch protein FliG GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 548213..549256 GB:FROM 548213 GB:TO 549256 GB:DIRECTION + GB:GENE fliG GB:PRODUCT flagellar motor switch protein FliG GB:PROTEIN_ID AAK86375.1 GB:DB_XREF GI:15155501 GB:GENE:GENE fliG LENGTH 347 SQ:AASEQ MMDFEDFGNPLAGKPLSQADKAAAVLLAMGKGVAGKLLKFFTQHELQMIISSAQTLRVIPPDELAQIVAEFEDLFTEGTGLMDNAKAIESILEEGLTPEEVDSLLGRRAAFQAYEASIWDRLQEAEPEFVGKFLLREHPQTIAYILSMLPSSFGAKVLLTIPEEQRADIMNRTVNMKEVSPTAAQIIEKRVVNLINEIEAERNAGGSTKVADLMNELDKPQVDTLLSSLETLSKEAANKVKPKIFLFDDLMFMPQRSRVLLLNDVSADVLTMALRGATVEIKECVLSSISPRQRRMIESDLAVPQASLNTREVAIARRAVAQEAIRLANSGQIQLKDVAAEEQSAAA GT:EXON 1|1-347:0| SW:ID FLIG_AGRT5 SW:DE RecName: Full=Flagellar motor switch protein fliG; SW:GN Name=fliG; OrderedLocusNames=Atu0563; ORFNames=AGR_C_989; SW:KW Bacterial flagellum; Cell membrane; Chemotaxis; Complete proteome;Flagellar rotation; Membrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->347|FLIG_AGRT5|0.0|100.0|347/347| GO:SWS:NREP 5 GO:SWS GO:0009288|"GO:bacterial-type flagellum"|Bacterial flagellum| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006935|"GO:chemotaxis"|Chemotaxis| GO:SWS GO:0001539|"GO:ciliary or flagellar motility"|Flagellar rotation| GO:SWS GO:0016020|"GO:membrane"|Membrane| SEG 224->233|tllssletls| BL:PDB:NREP 1 BL:PDB:REP 126->333|1lkvX|4e-23|28.0|207/213| RP:PDB:NREP 1 RP:PDB:REP 66->187|2bj9A|4e-10|11.0|118/133| RP:PFM:NREP 1 RP:PFM:REP 235->335|PF01706|2e-09|36.0|100/110|FliG_C| HM:PFM:NREP 2 HM:PFM:REP 226->336|PF01706|2e-27|32.7|110/110|FliG_C| HM:PFM:REP 138->238|PF03448|4.2e-07|24.7|93/102|MgtE_N| GO:PFM:NREP 4 GO:PFM GO:0001539|"GO:ciliary or flagellar motility"|PF01706|IPR000090| GO:PFM GO:0003774|"GO:motor activity"|PF01706|IPR000090| GO:PFM GO:0006935|"GO:chemotaxis"|PF01706|IPR000090| GO:PFM GO:0009288|"GO:bacterial-type flagellum"|PF01706|IPR000090| RP:SCP:NREP 1 RP:SCP:REP 126->335|1lkvX|2e-43|27.8|209/213|a.118.14.1| HM:SCP:REP 6->107|1lkvX_|1.3e-10|25.7|101/0|a.118.14.1|1/2|FliG| HM:SCP:REP 126->337|1lkvX_|1.4e-44|32.2|211/0|a.118.14.1|2/2|FliG| OP:NHOMO 493 OP:NHOMOORG 443 OP:PATTERN -------------------------------------------------------------------- 1111------------------------------------1---1---1--1-1--------1-1------------------11111--------------------1------------------------------------1---------------------------------------------111---------------111111---11111111----111------------------------------------------------------------------------------------------12111111111111111111---111--1111111111--11111111--11111111----1121111112112---1--11--1-2222212211111111111111111-111---1111-----------1111-121---------------------------------1-111111111211111111111111111111111--111111111--111111111121-------111-11111-1111111111111111111111-1--1-1111-1111111111111111111---12-111111111211121211121122221---11111--11121111111111111111-12112111-1112-11--1---1111111111111111111111---111111112221222222---------1111--111-------------------------1111111111211111111---------1111211111221111111111112------112222221111111122--------------------------1-11111111-1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 273 STR:RPRED 78.7 SQ:SECSTR #################################################################HHHHHHHHHHHHH#TcccHHHHHHHHHHHHHHHTTccccccEEEEEEEEEE##EETTcTTHHHHHHHHHHTTTTTEEEEEEEEccccEEEEEEEEEEEHHHHHHHHHHHTcTTEEEEEEEEEccHHHHHHHHHHHHcccccHHHHHHHHHTccHHHHHHHHHHHHHHcHHHHHHHHHHHccGGGGGGccHHHHHHHHTTccHHHHHHHHTTccHHHHHHHHTTccHHHHHHHHHHHHc#cccccHHHHHHHHHHHHHHHHHHHHTTcccccTTcccc##### DISOP:02AL 1-19, 194-208, 336-347| PSIPRED ccccHHHccccccccccHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHcccHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccEEEEccccccHHHccc //