[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fliI
DDBJ      :fliI         flagellum-specific ATP synthase
Swiss-Prot:FLII_AGRT5   RecName: Full=Flagellum-specific ATP synthase;         EC=3.6.3.14;

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
a.24.11c.37.1
:473 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   128->438 2oblA PDBj 4e-74 49.5 %
:RPS:PDB   43->443 2ck3E PDBj 8e-93 26.4 %
:RPS:SCOP  113->379 1bmfD3  c.37.1.11 * 3e-72 35.6 %
:RPS:SCOP  356->442 1g4uS1  a.24.11.1 * 3e-15 9.6 %
:HMM:SCOP  112->384 1e79A3 c.37.1.11 * 4.4e-94 48.9 %
:RPS:PFM   166->377 PF00006 * ATP-synt_ab 4e-40 39.8 %
:HMM:PFM   166->377 PF00006 * ATP-synt_ab 2.9e-71 39.6 212/215  
:BLT:SWISS 1->473 FLII_AGRT5 0.0 100.0 %
:PROS 368->377|PS00152|ATPASE_ALPHA_BETA
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86369.1 GT:GENE fliI GT:PRODUCT flagellum-specific ATP synthase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(542613..544034) GB:FROM 542613 GB:TO 544034 GB:DIRECTION - GB:GENE fliI GB:PRODUCT flagellum-specific ATP synthase GB:PROTEIN_ID AAK86369.1 GB:DB_XREF GI:15155495 GB:GENE:GENE fliI LENGTH 473 SQ:AASEQ MTMPESMLSESKLSGWAISPKLAQLASLAGHYADPEFSVAHGGHVRTIAAGHYTVSGLSRHVRLGEFVAHRSATGIHLGEVVRVEPDICYVCPIEPGEPIGIHDTVIRKGAFRVSPDESWCGRTINALGEPIDGQGPLASGIVRRSISNNAPPSMTRKRVETPFKTGVRAIDIFSPLCLGQRLGIFAGSGVGKSTLLSMLAKADAFDKVVIALVGERGREVREFIEDTMGDNMSKSVAVVATSDESPMLRKMAPLSAVTIAEHFRDQGDNVLLIIDSVTRFAHAIREVAVASGEPPVARGYPASVFTELPRLLERAGPGAEGTGTITAIVSILVDGDNHNDPIADSTRGILDGHIVLDRSLAEEGRYPPINPLASISRLAKKAWTPDQEKLVSRLKALVHRFEETRDLRLIGGYRPGTDPDLDMAVKQVPIIYETLKQLPDEPAAQDAYADLATALRGGAQNGQPQVNPRMRG GT:EXON 1|1-473:0| SW:ID FLII_AGRT5 SW:DE RecName: Full=Flagellum-specific ATP synthase; EC=3.6.3.14; SW:GN Name=fliI; OrderedLocusNames=Atu0557; ORFNames=AGR_C_980; SW:KW ATP synthesis; ATP-binding; Bacterial flagellum biogenesis;Bacterial flagellum protein export; Complete proteome; Cytoplasm;Hydrogen ion transport; Hydrolase; Ion transport; Nucleotide-binding;Protein transport; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->473|FLII_AGRT5|0.0|100.0|473/473| GO:SWS:NREP 10 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0043064|"GO:flagellum organization"|Bacterial flagellum biogenesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 368->377|PS00152|ATPASE_ALPHA_BETA|PDOC00137| SEG 444->456|aaqdayadlatal| BL:PDB:NREP 1 BL:PDB:REP 128->438|2oblA|4e-74|49.5|309/346| RP:PDB:NREP 1 RP:PDB:REP 43->443|2ck3E|8e-93|26.4|398/458| RP:PFM:NREP 1 RP:PFM:REP 166->377|PF00006|4e-40|39.8|211/212|ATP-synt_ab| HM:PFM:NREP 1 HM:PFM:REP 166->377|PF00006|2.9e-71|39.6|212/215|ATP-synt_ab| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF00006|IPR000194| RP:SCP:NREP 2 RP:SCP:REP 113->379|1bmfD3|3e-72|35.6|264/276|c.37.1.11| RP:SCP:REP 356->442|1g4uS1|3e-15|9.6|83/130|a.24.11.1| HM:SCP:REP 112->384|1e79A3|4.4e-94|48.9|272/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 4825 OP:NHOMOORG 1171 OP:PATTERN 22222222222222222222222222222222222222222222222622442222222222222222 3443433333333333333-33333333333333333333433343334334343333223342432443333333333333344844555535333333333333335355555555555555654333335335444333323444224422222222222422222222222222222223333355344444444444444444444443444444444446666664433333333333333333333522222222223322222332222222222222422422444242424444444444444422222222244444666666666646446555866553663433444464444444655547444443333646464444544544444444444-55555455554454445564444443444644757744433333333344634744444444433333333333333333333333344445554655576586865576999A4945954443344544544453654446544474333333346634444734664446555544444468888785353444434444444444444444464333463444546464645466544454455554323644444244454455464664444344-654455444464634433433355655666666666666666643445445746777776776763353333334666539473333333333333333332333333645545444464444456533333333344447444448764444555555563323334644444444444444466----2-46442424346422864444344464464554 4434334-D6524444454544444454444344444444434444244444423444444444444424434444434444444444-464444444444449CB246395979864334464854847f6-5755435735785544154364A46A66B56455A35C57546444k444439ADD4A54464444 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-21| PSIPRED cccccccHHcccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccEEEEEEcccccccccEEEEEcccccEEEEEEEEcccEEEEEEEccccccccccEEEEcccEEEEccccccEEEEcccccEEccccccccccEEcccccccccccccccccccccccHHHHHHHccccccccEEEEccccccHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccccEEEEEEEEEcccccccHHHHHHHHHEEEEEEEEHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccEEcc //