[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fliQ
DDBJ      :fliQ         flagellar biosynthetic protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->69 PF01313 * Bac_export_3 9e-06 32.3 %
:HMM:PFM   5->77 PF01313 * Bac_export_3 3.3e-26 35.6 73/76  
:BLT:SWISS 30->84 FLIQ_AQUAE 5e-08 34.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86391.1 GT:GENE fliQ GT:PRODUCT flagellar biosynthetic protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 564158..564424 GB:FROM 564158 GB:TO 564424 GB:DIRECTION + GB:GENE fliQ GB:PRODUCT flagellar biosynthetic protein GB:PROTEIN_ID AAK86391.1 GB:DB_XREF GI:15155521 GB:GENE:GENE fliQ LENGTH 88 SQ:AASEQ MNEADALDIMQAAVWTVLVAAGPAVLAAMIVGVAIAFIQALTQVQEMTLTFVPKIVTIMIVLGVAAPFVGAQIVLFSNLVFSRIQSGF GT:EXON 1|1-88:0| BL:SWS:NREP 1 BL:SWS:REP 30->84|FLIQ_AQUAE|5e-08|34.5|55/89| TM:NTM 2 TM:REGION 13->35| TM:REGION 53->75| SEG 17->28|vlvaagpavlaa| RP:PFM:NREP 1 RP:PFM:REP 5->69|PF01313|9e-06|32.3|65/76|Bac_export_3| HM:PFM:NREP 1 HM:PFM:REP 5->77|PF01313|3.3e-26|35.6|73/76|Bac_export_3| GO:PFM:NREP 2 GO:PFM GO:0009306|"GO:protein secretion"|PF01313|IPR002191| GO:PFM GO:0016020|"GO:membrane"|PF01313|IPR002191| OP:NHOMO 44 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----111------1--111111111111-11111-1111-11111111111111--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //