[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fliR
DDBJ      :fliR         flagellar biosynthetic protein FLIR
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  321/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:240 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->238 PF01311 * Bac_export_1 5e-20 30.5 %
:HMM:PFM   1->233 PF01311 * Bac_export_1 4.1e-45 27.4 230/249  
:BLT:SWISS 3->208 FLIR_CAUCR 2e-29 29.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86393.2 GT:GENE fliR GT:PRODUCT flagellar biosynthetic protein FLIR GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 566699..567421 GB:FROM 566699 GB:TO 567421 GB:DIRECTION + GB:GENE fliR GB:PRODUCT flagellar biosynthetic protein FLIR GB:PROTEIN_ID AAK86393.2 GB:DB_XREF GI:159139686 GB:GENE:GENE fliR LENGTH 240 SQ:AASEQ MFLAICRIGACFMTMPGFSSSRISPQIRMLLCVAVSMALLPVLWDTIYPKVSGASQGAVVGLIFSEVLIGAMYGLIARFYTLGFQFTGALIGASIGLSAPGGADPIEDVQENQIANFITFGGLLVLFMMDFHHIVLKALVDSYSATPVGALISGQKMLITLTDTLRASFSIMLRLASPFVIYGLMFNVAVGLINKLAPQIPVFFISTPFVLAGGLFMLYLSVAALIRQFVDGFGPVFIGF GT:EXON 1|1-240:0| BL:SWS:NREP 1 BL:SWS:REP 3->208|FLIR_CAUCR|2e-29|29.9|204/251| TM:NTM 6 TM:REGION 1->23| TM:REGION 25->47| TM:REGION 53->75| TM:REGION 117->139| TM:REGION 158->180| TM:REGION 208->230| RP:PFM:NREP 1 RP:PFM:REP 3->238|PF01311|5e-20|30.5|233/245|Bac_export_1| HM:PFM:NREP 1 HM:PFM:REP 1->233|PF01311|4.1e-45|27.4|230/249|Bac_export_1| GO:PFM:NREP 2 GO:PFM GO:0006605|"GO:protein targeting"|PF01311|IPR002010| GO:PFM GO:0016020|"GO:membrane"|PF01311|IPR002010| OP:NHOMO 348 OP:NHOMOORG 322 OP:PATTERN -------------------------------------------------------------------- 11----------------------------------------------1-------------1---------------------------------------------1--11111111-----1-------------------------------------------------------------------11----------------1--11------11--------11------------------------------------------------------------------------------------------11111111111111111------111--111-11111-111----11---1-111111----1121111112112111111111-1-2222212211111111111111111-111-1-2221111--------111--121--------------------------------11111-11-------------11---1-1----111--111111111--111111--1-2--------11--11111-11-11111111111111111----1-1--111------1111111-1-1-11---12-1111111-12111212---21-21221-----1----------1-11111-11-111-11111-11-1111-11------11---1-11111111111111-----------11111111111---------------111--------------------------1111111111---1-111---------1----1111122111--11-11112------1-11------------------------------------------111-1----1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 105-110| PSIPRED cHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccc //