[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fmt
DDBJ      :fmt          methionyl-tRNA formyl transferase
Swiss-Prot:FMT_AGRT5    RecName: Full=Methionyl-tRNA formyltransferase;         EC=2.1.2.9;

Homologs  Archaea  2/68 : Bacteria  899/915 : Eukaryota  166/199 : Viruses  0/175   --->[See Alignment]
b.46.1c.65.1e.8.1
:311 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->299 2fmtA PDBj 1e-63 45.4 %
:RPS:PDB   2->300 2cfiA PDBj 8e-77 28.1 %
:RPS:SCOP  27->88 1u09A  e.8.1.4 * 4e-04 12.9 %
:RPS:SCOP  64->200 1zghA2  c.65.1.1 * 3e-36 22.7 %
:RPS:SCOP  207->301 1fmtA1  b.46.1.1 * 6e-25 34.1 %
:HMM:SCOP  3->209 2blnA2 c.65.1.1 * 1.3e-64 45.3 %
:HMM:SCOP  207->310 1fmtA1 b.46.1.1 * 5.3e-25 44.0 %
:RPS:PFM   3->171 PF00551 * Formyl_trans_N 1e-18 42.2 %
:RPS:PFM   206->301 PF02911 * Formyl_trans_C 2e-18 48.9 %
:HMM:PFM   4->179 PF00551 * Formyl_trans_N 1.5e-39 35.5 172/181  
:HMM:PFM   206->301 PF02911 * Formyl_trans_C 2.9e-26 40.2 92/100  
:BLT:SWISS 1->311 FMT_AGRT5 e-178 100.0 %
:PROS 135->158|PS00373|GART

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86184.1 GT:GENE fmt GT:PRODUCT methionyl-tRNA formyl transferase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 361403..362338 GB:FROM 361403 GB:TO 362338 GB:DIRECTION + GB:GENE fmt GB:PRODUCT methionyl-tRNA formyl transferase GB:PROTEIN_ID AAK86184.1 GB:DB_XREF GI:15155279 GB:GENE:GENE fmt LENGTH 311 SQ:AASEQ MSLRIIFMGTPDFSVPTLRALVEAGHEIVAVYTQPPRPGGRRGLDLQKSPVHQVAELLGLPVLTPVNFKAEEDRQQFRDFNADVAVVVAYGLLLPEAILSGTRLGCYNGHASLLPRWRGAAPIQRAIMAGDAETGMMVMKMEKGLDTGPVALTAKVAIDENMTAGELHDSLMLAGARLMRQAMAKLEADDLPLVTQAEEGVLYAAKIDKGETRIDFSRPAQDVHNHIRGLSPFPGAWLEMDIGGKPERVKVLASELASGMGEAGSALDDALTIACGSDAVRLTRLQKAGGKPMSAADFVRGTPVPATTRLG GT:EXON 1|1-311:0| SW:ID FMT_AGRT5 SW:DE RecName: Full=Methionyl-tRNA formyltransferase; EC=2.1.2.9; SW:GN Name=fmt; OrderedLocusNames=Atu0367; ORFNames=AGR_C_642; SW:KW Complete proteome; Methyltransferase; Protein biosynthesis;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->311|FMT_AGRT5|e-178|100.0|311/311| GO:SWS:NREP 3 GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 135->158|PS00373|GART|PDOC00319| BL:PDB:NREP 1 BL:PDB:REP 2->299|2fmtA|1e-63|45.4|295/314| RP:PDB:NREP 1 RP:PDB:REP 2->300|2cfiA|8e-77|28.1|288/310| RP:PFM:NREP 2 RP:PFM:REP 3->171|PF00551|1e-18|42.2|161/179|Formyl_trans_N| RP:PFM:REP 206->301|PF02911|2e-18|48.9|92/100|Formyl_trans_C| HM:PFM:NREP 2 HM:PFM:REP 4->179|PF00551|1.5e-39|35.5|172/181|Formyl_trans_N| HM:PFM:REP 206->301|PF02911|2.9e-26|40.2|92/100|Formyl_trans_C| GO:PFM:NREP 4 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00551|IPR002376| GO:PFM GO:0016742|"GO:hydroxymethyl-, formyl- and related transferase activity"|PF00551|IPR002376| GO:PFM GO:0009058|"GO:biosynthetic process"|PF02911|IPR005793| GO:PFM GO:0016742|"GO:hydroxymethyl-, formyl- and related transferase activity"|PF02911|IPR005793| RP:SCP:NREP 3 RP:SCP:REP 27->88|1u09A|4e-04|12.9|62/476|e.8.1.4| RP:SCP:REP 64->200|1zghA2|3e-36|22.7|128/164|c.65.1.1| RP:SCP:REP 207->301|1fmtA1|6e-25|34.1|91/108|b.46.1.1| HM:SCP:REP 3->209|2blnA2|1.3e-64|45.3|203/0|c.65.1.1|1/1|Formyltransferase| HM:SCP:REP 207->310|1fmtA1|5.3e-25|44.0|100/108|b.46.1.1|1/1|FMT C-terminal domain-like| OP:NHOMO 1386 OP:NHOMOORG 1067 OP:PATTERN ---------------------------------------------1-----1---------------- 1111111111121221111-11111211111111111222111311111111111111111211222122111111111111111111111111111--11111111122111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111212112111211111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111121211111111111111211111111111111111111111111111111111122222222221-22222314111111111121112211111111111111111111111111111111111111111111111111111111111111111112411222222222222222122222222222223222111111111111121111211111111111111211112111212211221221222111112111211111111111111111111111112211121111121111111111111111211-1111111111111222222222222222-222222222222222222222222222212222222222222122121122222222222222221121111111111111111111111111111111111111111112222122211111112211111111111111111112111111111111111111111111111111111111111----1-111-111---1111111111111111111121 ----12----1-111111111--111-11-111111-11111111111112-1--1--1111111--1111111-1111111111111--1111111111---111-11142333313221331322628H3-456322-32243-32213125222232122322-32221141122171111111111111121-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 310 STR:RPRED 99.7 SQ:SECSTR cccEEEEEccHHHHHHHHHHHHHTTcEEEEEEEcccccccccHHHHcccHHHHHHHHHTccEEEccccEETTEEHHHHHTcccEEEEccccccccHHHHTccTTcEEEEEcccTTTTccccHHHHHHHTTccEEEEEEEEcccccccccEEEEEEEEccTTccHHHHHHHTTTHHHHHHHHHHHHHHTTcccccccccTTccccccccGGGGcccccccHHHHHHHHHTTTTTTcEEEEETETTETEEEEEEEEEcccTccEEEccTTEEEEEcTTccEEEEEEEEcTTccEEEGGGTTcHHTccTTccc# DISOP:02AL 311-312| PSIPRED ccEEEEEEcccHHHHHHHHHHHHccccEEEEEEccccHHHHccccccccHHHHHHHHccccEEEccccccHHHHHHHHHccccEEEEccccHHccHHHHHHccccEEEEccccccccccccHHHHHHHccccEEEEEEEEEEcccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccHHHEEEcccccHHHHHHHHcccccccEEEEEEccccEEEEEEEEEccccccccccEEEEcccEEEEEcccEEEEEEEEccccccccHHHHHHccccccccccc //