[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : ftsQ
DDBJ      :ftsQ         cell division protein
Swiss-Prot:FTSQ_RHIRD   RecName: Full=Cell division protein ftsQ homolog;Flags: Fragment;

Homologs  Archaea  0/68 : Bacteria  137/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:317 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   118->282 2vh2B PDBj 3e-08 23.8 %
:RPS:PDB   96->298 3efcA PDBj 2e-17 13.8 %
:RPS:PFM   99->165 PF08478 * POTRA_1 5e-08 31.3 %
:RPS:PFM   171->282 PF03799 * FtsQ 2e-07 34.3 %
:HMM:PFM   169->282 PF03799 * FtsQ 3.8e-24 32.4 111/117  
:HMM:PFM   97->165 PF08478 * POTRA_1 1.3e-21 37.7 69/69  
:BLT:SWISS 108->317 FTSQ_RHIRD e-116 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87838.2 GT:GENE ftsQ GT:PRODUCT cell division protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(2050291..2051244) GB:FROM 2050291 GB:TO 2051244 GB:DIRECTION - GB:GENE ftsQ GB:PRODUCT cell division protein GB:PROTEIN_ID AAK87838.2 GB:DB_XREF GI:159140317 GB:GENE:GENE ftsQ LENGTH 317 SQ:AASEQ MDGGGRFVFAVTGKKSTAKKREQYAATANADDRRVLPRPLRRFVRFGVSLATGRIHIPAHTGTISAVAFYAMIGLYGMSLGGHTNIVTQTTTSAAGFAVEDVKVSGNLQTSEIEVFQLLGLDGSTSLIALDIDAARRKLVQLPWVEDVDIRKVYPKTVEVRLKERQAFGIWQHGTELSLIEKSGSVIAPLRDNKFAALPLFVGRDAETGAAGFVAQLADWPEIRNRVRAYVRIAGRRWDLHLDNGIVVKLPEENLPQALQLLARLDLEEKVLSRDVAAVDLRLTDRTTIQLTEGAAERRQTAVDARTKALKKAEKNT GT:EXON 1|1-317:0| SW:ID FTSQ_RHIRD SW:DE RecName: Full=Cell division protein ftsQ homolog;Flags: Fragment; SW:GN Name=ftsQ; SW:KW Cell cycle; Cell division; Cell inner membrane; Cell membrane;Membrane; Septation; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 108->317|FTSQ_RHIRD|e-116|100.0|210/210| GO:SWS:NREP 7 GO:SWS GO:0007049|"GO:cell cycle"|Cell cycle| GO:SWS GO:0051301|"GO:cell division"|Cell division| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000917|"GO:barrier septum formation"|Septation| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 60->82| SEG 31->46|ddrrvlprplrrfvrf| BL:PDB:NREP 1 BL:PDB:REP 118->282|2vh2B|3e-08|23.8|160/201| RP:PDB:NREP 1 RP:PDB:REP 96->298|3efcA|2e-17|13.8|203/327| RP:PFM:NREP 2 RP:PFM:REP 99->165|PF08478|5e-08|31.3|67/69|POTRA_1| RP:PFM:REP 171->282|PF03799|2e-07|34.3|108/116|FtsQ| HM:PFM:NREP 2 HM:PFM:REP 169->282|PF03799|3.8e-24|32.4|111/117|FtsQ| HM:PFM:REP 97->165|PF08478|1.3e-21|37.7|69/69|POTRA_1| OP:NHOMO 137 OP:NHOMOORG 137 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111111111111111111111111-11111111111111111111111111111--1--111-111111111111111-11111-----------------------------------------------------111--1111111-----------1-11-1111--------------1-----------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 64.0 SQ:SECSTR ###############################################################################################cccEEEEEccccccccHHHHHHTccccTTccccTHHHHHHHHHHHHHccEEEEEEEccccEEEEEEEEccEEEEEEEEccTTccHHHHHHHHHHHTccccccccGGGHHHHHHHHHHHHHTTTccccEEEEEccccTTcEEEEEEEEEccccccccccEEEccccccTTTTGGGcccccccccccccTTTHHHHHHHHHHHHH################### DISOP:02AL 1-2,301-318| PSIPRED cccccEEEEEEEEccccccEEEccccccccccHHccHHHHHccEEEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccEEccHHHHHHHHcccccccEEEEcHHHHHHHHHHccccEEEEEEEEcccEEEEEEEEEEEEEEEEEccEEEEEccccEEEEcccccccccccEEEccccHHHHHHHHHHHHHHHHHHHcHHEEEEEcccEEEEEEcccEEEEEccccHHHHHHHHHHHHHHHccccccEEEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHHccccc //