[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fur
DDBJ      :fur          ferric uptake regulator
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  693/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->134 2w57A PDBj 2e-22 40.5 %
:RPS:PDB   15->89 2co5B PDBj 7e-07 15.3 %
:RPS:SCOP  8->135 1mzbA  a.4.5.42 * 8e-27 35.2 %
:HMM:SCOP  6->135 1mzbA_ a.4.5.42 * 1.2e-36 42.3 %
:RPS:PFM   16->132 PF01475 * FUR 2e-20 47.9 %
:HMM:PFM   14->133 PF01475 * FUR 8.8e-46 53.3 120/120  
:BLT:SWISS 1->141 FUR_RHILV 2e-67 84.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86171.1 GT:GENE fur GT:PRODUCT ferric uptake regulator GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 348239..348667 GB:FROM 348239 GB:TO 348667 GB:DIRECTION + GB:GENE fur GB:PRODUCT ferric uptake regulator GB:PROTEIN_ID AAK86171.1 GB:DB_XREF GI:15155264 GB:GENE:GENE fur LENGTH 142 SQ:AASEQ MIDLSKTLEELCAERGMRMTDQRRVIARVLQESADHPDVEELYRRSSAVDPRISISTVYRTVKLFEDAGIIERHDFRDGRSRYETVPEEHHDHLIDLKNSVVIEFHSPEIEALQEKIAREHGFKLVDHRLELYGVPLKPEER GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 1->141|FUR_RHILV|2e-67|84.4|141/142| BL:PDB:NREP 1 BL:PDB:REP 14->134|2w57A|2e-22|40.5|121/131| RP:PDB:NREP 1 RP:PDB:REP 15->89|2co5B|7e-07|15.3|72/94| RP:PFM:NREP 1 RP:PFM:REP 16->132|PF01475|2e-20|47.9|117/120|FUR| HM:PFM:NREP 1 HM:PFM:REP 14->133|PF01475|8.8e-46|53.3|120/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 8->135|1mzbA|8e-27|35.2|128/133|a.4.5.42| HM:SCP:REP 6->135|1mzbA_|1.2e-36|42.3|130/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 893 OP:NHOMOORG 694 OP:PATTERN --------------------------------------------------1----------------- 121-111111111111111-11111111111111111111121121111---1111-1--112---11111----111----221123-----------111111-2111---------------11113221122---11223-1511211211222--2--1-112222111----1--1--11--11-222222222222222222224422222232222222222225222222222222222211222-1-11-----11--112111----------------------------------------11111111-13211121111132221441222121212--2-22522123233221---111111111111--1112111111111111111111---------2-1-2112111111111111111111111111111111111111211-----------------------------111111111111111112111111211111111112222112221111131111111111111111111111111112421-1121331121212223122222212212121111111111111111111-1111113111111111122112111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--111111111-1111111111111111111111111111111111111111111111111111111111111111222222111111111111111111111-111111-------------------------------------2--111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 85.9 SQ:SECSTR #############cTTccHHHHHHHHHHHHTTTcEEEGGGHHHHHHHHHcccccHHHHHHHHHHHHHTTcEEEEEcccTTccEEEEcHHccHHHHHHTTccEEEEccHHHHHHHHHHHHHTTccccccccEEEEc####### DISOP:02AL 1-4, 141-142| PSIPRED cccHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEcccEEEEEEcccccccEEEEcccccEEEcccccHHHHHHHHHHHHccEEEEEEEEEEEEcHHHHcc //