[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : fxsA
DDBJ      :fxsA         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->107 PF04186 * FxsA 1e-14 39.6 %
:HMM:PFM   8->119 PF04186 * FxsA 9.6e-38 44.6 112/120  
:BLT:SWISS 66->132 FXSA_SERMA 3e-05 35.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85832.1 GT:GENE fxsA GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(4493..5029) GB:FROM 4493 GB:TO 5029 GB:DIRECTION - GB:GENE fxsA GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK85832.1 GB:DB_XREF GI:15154865 GB:GENE:GENE fxsA LENGTH 178 SQ:AASEQ MRFSFLPIVILMMPILEIAGFIIVGKAIGLWLTLALILFTSFLGLLILRLGGVGMVRNLQAAGRTGAQPADELVNGAMRVVAGILLIIPGFITDILGLLLLSPAIRRFFWKAFGPRVVVSGSFRQSGPQQGDYSGFRNGPGPAGNSKVVDLDEEEFHREGSKDSPWSNRPDDRDLPKP GT:EXON 1|1-178:0| BL:SWS:NREP 1 BL:SWS:REP 66->132|FXSA_SERMA|3e-05|35.9|64/139| TM:NTM 3 TM:REGION 4->26| TM:REGION 32->54| TM:REGION 79->101| SEG 34->54|lalilftsflgllilrlggvg| RP:PFM:NREP 1 RP:PFM:REP 7->107|PF04186|1e-14|39.6|101/122|FxsA| HM:PFM:NREP 1 HM:PFM:REP 8->119|PF04186|9.6e-38|44.6|112/120|FxsA| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF04186|IPR007313| OP:NHOMO 48 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-------------11111111111---------11--111-11111111-------1----1-1--------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------1---1111----------------1------------------------------------------------------------------------------------------------------------1--------------------------------------------------------1---11111---11------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 63-66, 125-151, 153-178| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEcccccccccccccccccccc //