[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : gatB
DDBJ      :gatB         glutamyl-tRNA amidotransferase subunit B
Swiss-Prot:GATB_AGRT5   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B;         Short=Asp/Glu-ADT subunit B;         EC=6.3.5.-;

Homologs  Archaea  57/68 : Bacteria  720/915 : Eukaryota  178/199 : Viruses  0/175   --->[See Alignment]
a.182.1d.128.1
:501 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->434 3h0lB PDBj 3e-98 46.1 %
:RPS:PDB   22->430 2dqnB PDBj e-159 46.4 %
:RPS:SCOP  22->319 2df4B2  d.128.1.5 * e-123 49.3 %
:RPS:SCOP  320->423 2df4B1  a.182.1.2 * 1e-31 39.4 %
:HMM:SCOP  23->319 2f2aB2 d.128.1.5 * 1.4e-114 58.5 %
:HMM:SCOP  320->425 2f2aB1 a.182.1.2 * 5.9e-35 51.9 %
:RPS:PFM   24->295 PF02934 * GatB_N 4e-84 56.6 %
:RPS:PFM   352->496 PF02637 * GatB_Yqey 3e-38 57.9 %
:HMM:PFM   23->313 PF02934 * GatB_N 9.5e-117 51.7 286/289  
:HMM:PFM   352->496 PF02637 * GatB_Yqey 2.7e-52 46.2 145/149  
:BLT:SWISS 1->501 GATB_AGRT5 0.0 100.0 %
:PROS 168->182|PS01234|GATB
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87115.2 GT:GENE gatB GT:PRODUCT glutamyl-tRNA amidotransferase subunit B GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1312454..1313959 GB:FROM 1312454 GB:TO 1313959 GB:DIRECTION + GB:GENE gatB GB:PRODUCT glutamyl-tRNA amidotransferase subunit B GB:PROTEIN_ID AAK87115.2 GB:DB_XREF GI:159140001 GB:GENE:GENE gatB LENGTH 501 SQ:AASEQ MTLVDVRTPDPKRFIPGATGDWEIVIGLEVHAQVLSNSKLFSGASTTFGNAPNSNVSLVDAAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPDLPQGYQISQFKDPIVGEGTITISLGPDRQGNFEDIEIGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVSKPDMRSSDEAKGYLTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEGFGTRCEIKNVNSIRFVGQAIEYEARRQVAILEDGGVIDQETRLFDPGKGETRSMRSKEDAHDYRYFPDPDLLPLEFDDAFVEALKVDLPELPDDKKARFVADLGLSVYDASILVSEKAIADYYEAVAAGRDAKTAANWVINDLLGALNKFGKDIETTPVSPDQLGGIIDLIKAETISGKIAKDLFEIVWNEGGNPAEIVEARGMKQVTDTGAIEKAVDDIIAANPDQVEKVKAKPTLAGWFVGQVMKATGGKANPQAVQALVKAKLGIEDE GT:EXON 1|1-501:0| SW:ID GATB_AGRT5 SW:DE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; Short=Asp/Glu-ADT subunit B; EC=6.3.5.-; SW:GN Name=gatB; OrderedLocusNames=Atu1324; ORFNames=AGR_C_2438; SW:KW ATP-binding; Complete proteome; Ligase; Nucleotide-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->501|GATB_AGRT5|0.0|100.0|501/501| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 168->182|PS01234|GATB|PDOC00948| SEG 296->310|fpdpdllplefddaf| BL:PDB:NREP 1 BL:PDB:REP 22->434|3h0lB|3e-98|46.1|406/410| RP:PDB:NREP 1 RP:PDB:REP 22->430|2dqnB|e-159|46.4|401/405| RP:PFM:NREP 2 RP:PFM:REP 24->295|PF02934|4e-84|56.6|267/288|GatB_N| RP:PFM:REP 352->496|PF02637|3e-38|57.9|145/148|GatB_Yqey| HM:PFM:NREP 2 HM:PFM:REP 23->313|PF02934|9.5e-117|51.7|286/289|GatB_N| HM:PFM:REP 352->496|PF02637|2.7e-52|46.2|145/149|GatB_Yqey| GO:PFM:NREP 4 GO:PFM GO:0006412|"GO:translation"|PF02934|IPR006075| GO:PFM GO:0016874|"GO:ligase activity"|PF02934|IPR006075| GO:PFM GO:0006412|"GO:translation"|PF02637|IPR018027| GO:PFM GO:0016884|"GO:carbon-nitrogen ligase activity, with glutamine as amido-N-donor"|PF02637|IPR018027| RP:SCP:NREP 2 RP:SCP:REP 22->319|2df4B2|e-123|49.3|290/292|d.128.1.5| RP:SCP:REP 320->423|2df4B1|1e-31|39.4|104/107|a.182.1.2| HM:SCP:REP 23->319|2f2aB2|1.4e-114|58.5|289/0|d.128.1.5|1/1|Glutamine synthetase/guanido kinase| HM:SCP:REP 320->425|2f2aB1|5.9e-35|51.9|106/0|a.182.1.2|1/1|GatB/YqeY motif| OP:NHOMO 1057 OP:NHOMOORG 955 OP:PATTERN 22121222222222221-111112222222112112212222211112222111--1--------112 1111111111111111111-1111111111111111111111111111111111111111111111111111111111-111111111--------1--------1112111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-2111111111111-111---11211111122211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111111111111111111211----11--------------------------11111---------------------------------------------------------------------------------------------11111111111111---------------111111111111111111111111111111111111111----------------------------11111111111111111111-----1-11111111111111111111111111111111 ----111-------1111111111111111111111111111111111111111111-1111111111111111121-1111111112-1211111111-111111-1-11211122111111131111191-1111111211211111111111111113111111111A-1-11-12E2221111131421111112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 469 STR:RPRED 93.6 SQ:SECSTR ####################HcEEEEEEEEEEEccccccccccccccccccTTccccTTTTTcTTccccccHHHHHHHHHHHHTTTcEEccEEccEEEEcccTTccccEEEEccccccEEEEEEEEEccccEEEcccEEEEEEEEEEEEEcccEEEEETTTTEEEEEcccTTcEEEEEEEcTTcccHHHHHHHHHHHHHHHHHTTcccccTTTTcEEEEEEEEEEcTTcccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcTTTccEEEEEEcccccccccEEcTTcccEEccHHHHHHHHHTccccHHHHHHHHHcTTcccHHHHHHHTccHHHHHHHHHHHHTccHHHHHHHHHTTHHHHHHHHTcccTTTcccHHHHHHHHHHHHTTcccGGGHHHHHHHHHHTccccTTHHHTTcccHEEEEHHHHHHHHTTcTTTcccHHHHHTTTTHHHHHHTTccc###ccGGGHHHHHHH######### DISOP:02AL 1-1,499-502| PSIPRED ccEEEEcccccccccccccccccEEEEEEEEEEEcccccccccccccccccccccEEEEEcccccccccccHHHHHHHHHHHHHHccEEccEEEEEEEEEEccccccccEEcHHcccEEcccEEEEEEcccccccccEEEEEEEEEEEEccccHHcccccccEEEEEEccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEcccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEccccccccccccccccccccEEEcHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccc //