[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : gatC
DDBJ      :gatC         glutamyl-tRNA-Gln-amidotransferase chain C
Swiss-Prot:GATC_AGRT5   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C;         Short=Asp/Glu-ADT subunit C;         EC=6.3.5.-;

Homologs  Archaea  1/68 : Bacteria  359/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.137.12
:95 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->94 2g5hC PDBj 2e-09 32.2 %
:RPS:PDB   3->95 2dqnC PDBj 3e-25 31.2 %
:RPS:SCOP  3->95 2df4C1  a.137.12.1 * 2e-25 31.2 %
:HMM:SCOP  2->93 2f2aC1 a.137.12.1 * 1.9e-31 43.5 %
:RPS:PFM   19->90 PF02686 * Glu-tRNAGln 6e-09 44.4 %
:HMM:PFM   19->90 PF02686 * Glu-tRNAGln 9.2e-28 44.4 72/72  
:BLT:SWISS 1->95 GATC_AGRT5 5e-49 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87109.2 GT:GENE gatC GT:PRODUCT glutamyl-tRNA-Gln-amidotransferase chain C GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1308566..1308853 GB:FROM 1308566 GB:TO 1308853 GB:DIRECTION + GB:GENE gatC GB:PRODUCT glutamyl-tRNA-Gln-amidotransferase chain C GB:PROTEIN_ID AAK87109.2 GB:DB_XREF GI:159139996 GB:GENE:GENE gatC LENGTH 95 SQ:AASEQ MSVDLATVKRVARLARIAVSEEEAQNMLGQLNGILGFVEQLSEVNVDGVEPMTSVTPVEMKKRADVVTDGNKADDIVANAPATDRDFFMVPKVVE GT:EXON 1|1-95:0| SW:ID GATC_AGRT5 SW:DE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C; EC=6.3.5.-; SW:GN Name=gatC; OrderedLocusNames=Atu1318; ORFNames=AGR_C_2429; SW:KW ATP-binding; Complete proteome; Ligase; Nucleotide-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->95|GATC_AGRT5|5e-49|100.0|95/95| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 8->94|2g5hC|2e-09|32.2|87/99| RP:PDB:NREP 1 RP:PDB:REP 3->95|2dqnC|3e-25|31.2|93/98| RP:PFM:NREP 1 RP:PFM:REP 19->90|PF02686|6e-09|44.4|72/72|Glu-tRNAGln| HM:PFM:NREP 1 HM:PFM:REP 19->90|PF02686|9.2e-28|44.4|72/72|Glu-tRNAGln| GO:PFM:NREP 1 GO:PFM GO:0006450|"GO:regulation of translational fidelity"|PF02686|IPR003837| RP:SCP:NREP 1 RP:SCP:REP 3->95|2df4C1|2e-25|31.2|93/99|a.137.12.1| HM:SCP:REP 2->93|2f2aC1|1.9e-31|43.5|92/0|a.137.12.1|1/1|Glu-tRNAGln amidotransferase C subunit| OP:NHOMO 360 OP:NHOMOORG 360 OP:PATTERN ------------------------------------------------1------------------- 1-----11----1-------------------------11---1----------------------1------------------111-----------------111-1---------------11111111111111--1111-1111111--1111111-11111111-111-----11--1------111111111111111111111111111111111-111111111---------------------1----------------1--1----------------------------------------------11--1-1111111111--------1-----1-11--1--1--1-1111--1-11111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11--111----------1--1----------111111111111111111111111-111111111-1111111111-11111111111111111111111-1111-1111-11111111--1--1-1-1111----1-------------1-------------111----11----------------------------111------------------------------------------------------------------------------------------------------11111---------------1111111--11111111111111111111--------------------------------------1-1------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 97.9 SQ:SECSTR ##ccHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHGGGGGcccTTccccccccccccccccccccccccHHHHHTTcccccccccccccccc DISOP:02AL 1-1| PSIPRED ccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEccccccccccccccccHHHHHHHcHHHcccEEEcccccc //