[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : glk
DDBJ      :glk          glucokinase
Swiss-Prot:GLK_AGRT5    RecName: Full=Glucokinase;         EC=2.7.1.2;AltName: Full=Glucose kinase;

Homologs  Archaea  0/68 : Bacteria  327/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:340 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->324 1sz2A PDBj 7e-44 37.0 %
:RPS:PDB   141->324 3bp8A PDBj 7e-15 17.5 %
:RPS:SCOP  11->111 1q18A1  c.55.1.7 * 4e-09 29.0 %
:RPS:SCOP  125->324 1q18A2  c.55.1.7 * 2e-46 38.5 %
:HMM:SCOP  13->331 1sz2A1 c.55.1.7 * 3.2e-51 30.5 %
:RPS:PFM   15->324 PF02685 * Glucokinase 3e-68 42.9 %
:HMM:PFM   15->325 PF02685 * Glucokinase 1.2e-111 43.4 311/316  
:BLT:SWISS 1->340 GLK_AGRT5 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86004.2 GT:GENE glk GT:PRODUCT glucokinase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(186737..187759) GB:FROM 186737 GB:TO 187759 GB:DIRECTION - GB:GENE glk GB:PRODUCT glucokinase GB:PROTEIN_ID AAK86004.2 GB:DB_XREF GI:159139531 GB:GENE:GENE glk LENGTH 340 SQ:AASEQ MPKTSDTEYLSFPILLGDIGGTNARFSILIDSFAEPVHLTTVKTAEYPGIDDAIQQAVLDKTSLQPVSTILAIAGPIEGDEIPLTNCHWVVKPKDMLAKLGLKDVIVINDFEAQALAIAALDDDNREPIGSGKKDMLASRVVLGPGTGLGVAGLVYARHMWFPVPGEGGHIDIGPRSARDYVVFPHIETIEGRVAGEQILCGRGLVNLYRAICKADGIEPVFSDPADITSQGLSGQNAQAKETLSLFSTYLGRVAGDLALIFMAKGGVYLAGGISQKIIPALKSPEFRAAFEDKAPHSALMRTIPTFVVTHPQAALSGLATYARTPADFGLALDGRRWRA GT:EXON 1|1-340:0| SW:ID GLK_AGRT5 SW:DE RecName: Full=Glucokinase; EC=2.7.1.2;AltName: Full=Glucose kinase; SW:GN Name=glk; OrderedLocusNames=Atu0184; ORFNames=AGR_C_310; SW:KW ATP-binding; Complete proteome; Cytoplasm; Glycolysis; Kinase;Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->340|GLK_AGRT5|0.0|100.0|340/340| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006096|"GO:glycolysis"|Glycolysis| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 113->124|aqalaiaalddd| BL:PDB:NREP 1 BL:PDB:REP 15->324|1sz2A|7e-44|37.0|300/314| RP:PDB:NREP 1 RP:PDB:REP 141->324|3bp8A|7e-15|17.5|171/381| RP:PFM:NREP 1 RP:PFM:REP 15->324|PF02685|3e-68|42.9|310/314|Glucokinase| HM:PFM:NREP 1 HM:PFM:REP 15->325|PF02685|1.2e-111|43.4|311/316|Glucokinase| GO:PFM:NREP 3 GO:PFM GO:0004340|"GO:glucokinase activity"|PF02685|IPR003836| GO:PFM GO:0005524|"GO:ATP binding"|PF02685|IPR003836| GO:PFM GO:0006096|"GO:glycolysis"|PF02685|IPR003836| RP:SCP:NREP 2 RP:SCP:REP 11->111|1q18A1|4e-09|29.0|100/110|c.55.1.7| RP:SCP:REP 125->324|1q18A2|2e-46|38.5|200/210|c.55.1.7| HM:SCP:REP 13->331|1sz2A1|3.2e-51|30.5|318/0|c.55.1.7|1/1|Actin-like ATPase domain| OP:NHOMO 401 OP:NHOMOORG 343 OP:PATTERN -------------------------------------------------------------------- 1--------------------------------------------------------------------------------------------------1------------------------------------111-------11111111111111111-111111111111-11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------2222-----21211111-1--111111111111-1111211111111111111111111211111-111111----------1111111------------------------------11111-----1111111111111111111111111111--1112-----1---1--11---1-1111111111111--1-1--1--1--1-1-1-----------11----------1-1-1111111-------1111115-112----------------------1111------11111111111111111-11111111111111111111111-11-111111111111111111111111--111111111111---------11111-111-------------------------21111111111111121111111111111--------------33323222222222--------------------------------------------------------1-- ------1-----------------------------------------------------------------------------------------------------7------------------------------------------------------1------------111511--1-------1-54532 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 325 STR:RPRED 95.6 SQ:SECSTR ##########cccEEEEEccccccEEEcccccccccccHHHHHHHHHHcHHHHHHHHHHHHTccEEEEEcccccccccccEEEETTccccHHHTGGGTTcccccccEEEHHHHHHTTcHTccccEEEEcTTGGGccTTccEEEcccEEEEEEETTEEccccccccccGGGcccccccccccccccccccHHHHHHHTTTccHHHHHHHHHTTTTTccccccccHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHcccEcEEEEEcGGGGGHHHHGHHHHHHHHHHHccHHHHTTccEEEccccTTcGGGGHHHHHHHTTTccccccH##### DISOP:02AL 1-8,334-341| PSIPRED cccccccccccccEEEEEEccccEEEEEEEcccccEEEEEEEcccccccHHHHHHHHHHccccccccEEEEEccccccccEEEEccccccccHHHHHHHHcccEEEEEEcHHHHHHHHHcccHHHEEEEccccccccccEEEEEcccccEEEEEEEcccccEEEcccccccccccccHHHHHHHHHHHHHccEEEHHHEEEHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHcccHHHHHHHHcccccHHHHHHccEEEEEccccccHHHHHHHHHHHHcccccccccccc //