[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : gmk.1
DDBJ      :gmk          guanylate kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  150/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->149 2zzyA PDBj 3e-09 33.1 %
:RPS:PDB   1->176 2cdnA PDBj 4e-10 20.2 %
:RPS:SCOP  1->176 1jxmA2  c.37.1.1 * 2e-19 21.9 %
:HMM:SCOP  1->179 1t0hB_ c.37.1.1 * 2e-29 33.7 %
:RPS:PFM   1->176 PF00625 * Guanylate_kin 8e-13 35.3 %
:HMM:PFM   2->176 PF00625 * Guanylate_kin 1.5e-09 28.9 173/183  
:BLT:SWISS 3->164 TYPH1_RALEJ 6e-34 44.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK85987.2 GT:GENE gmk.1 GT:PRODUCT guanylate kinase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(172384..172935) GB:FROM 172384 GB:TO 172935 GB:DIRECTION - GB:GENE gmk GB:PRODUCT guanylate kinase GB:PROTEIN_ID AAK85987.2 GB:DB_XREF GI:159139524 GB:GENE:GENE gmk LENGTH 183 SQ:AASEQ MIVIVGPSGAGKDTLMDYAAAQLSGRPGFHFTRRVITRSCDAGGENHDAVSMHEFNQLEDAGAFAVSWQAHGLKYGIPAAVYRHLEAGDVVIANGSRSALPHFGTAFSRLKVVNIVARPDVLARRLEQRGRESRDDILRRLERSSLAVAGDFDVTTVDNSGAIEDAGKTIMQVLQQSAGSSQP GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 3->164|TYPH1_RALEJ|6e-34|44.1|161/602| BL:PDB:NREP 1 BL:PDB:REP 2->149|2zzyA|3e-09|33.1|142/186| RP:PDB:NREP 1 RP:PDB:REP 1->176|2cdnA|4e-10|20.2|173/186| RP:PFM:NREP 1 RP:PFM:REP 1->176|PF00625|8e-13|35.3|170/183|Guanylate_kin| HM:PFM:NREP 1 HM:PFM:REP 2->176|PF00625|1.5e-09|28.9|173/183|Guanylate_kin| RP:SCP:NREP 1 RP:SCP:REP 1->176|1jxmA2|2e-19|21.9|169/199|c.37.1.1| HM:SCP:REP 1->179|1t0hB_|2e-29|33.7|172/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 160 OP:NHOMOORG 150 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---1111111111111111---1--1-113--11111111111121----11----211--------1------------------------------------------------------1111--1111111---12121------2--1---111-1-1---11-------------------11-------------------------------------------------11----4-----1------------------1-------------1-11-1-111-111111-111111111111111111-11111----1--------------11-1---1--111111111111-------------------------------------------1-11111-11111111111---------1--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 100.0 SQ:SECSTR EEEEEccTTccHHHHHHHHHHHHHTccEEEHHHHHHHHHHTTcHHHHHHHHHHHHTccccHHHHHHHHHHHTTcGGGTTcEEEEcccccHHHHHHHHHHHHHTTccccccEEEEEEccHHHHHHHHHHHccccHHHHHHHHHHTTHHHHTTTTEEEEEccccHHHHHHHHHHHTTcHHHHTTH DISOP:02AL 126-138,176-176,178-184| PSIPRED cEEEEccccccHHHHHHHHHHHccccccEEEEEEccccccccccccEEcccHHHHHHHHHccccEEEEEEccccccccHHHHHHHHccccEEEEccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHHHHccccc //