[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : gntK
DDBJ      :gntK         gluconokinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  321/915 : Eukaryota  148/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->159 1ko5A PDBj 1e-27 46.0 %
:RPS:PDB   1->151 3cr8B PDBj 2e-16 22.3 %
:RPS:SCOP  1->159 1knqA  c.37.1.17 * 3e-25 46.2 %
:HMM:SCOP  1->162 3adkA_ c.37.1.1 * 3.3e-22 25.9 %
:RPS:PFM   6->151 PF01202 * SKI 1e-11 43.1 %
:HMM:PFM   5->114 PF01202 * SKI 1.3e-13 29.4 102/158  
:BLT:SWISS 1->149 GNTK_SCHPO 3e-34 50.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86014.1 GT:GENE gntK GT:PRODUCT gluconokinase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(199684..200175) GB:FROM 199684 GB:TO 200175 GB:DIRECTION - GB:GENE gntK GB:PRODUCT gluconokinase GB:PROTEIN_ID AAK86014.1 GB:DB_XREF GI:15155081 GB:GENE:GENE gntK LENGTH 163 SQ:AASEQ MMGVSGSGKSTVAEGLAEKLGIAFIEGDKLHPKSNVDKMSEGIPLTDDDRWPWLDLIGAELRNGSEGKGVLVSCSALKKIYRDRLREATGGPLAFVYLDGSLELLSRRMGERKGHFMPLSLLQTQLATLEVPTGEPGVVTVSIDSTPEEIVANALAGLKTLKF GT:EXON 1|1-163:0| BL:SWS:NREP 1 BL:SWS:REP 1->149|GNTK_SCHPO|3e-34|50.0|148/193| BL:PDB:NREP 1 BL:PDB:REP 19->159|1ko5A|1e-27|46.0|139/172| RP:PDB:NREP 1 RP:PDB:REP 1->151|3cr8B|2e-16|22.3|121/493| RP:PFM:NREP 1 RP:PFM:REP 6->151|PF01202|1e-11|43.1|137/156|SKI| HM:PFM:NREP 1 HM:PFM:REP 5->114|PF01202|1.3e-13|29.4|102/158|SKI| GO:PFM:NREP 2 GO:PFM GO:0004765|"GO:shikimate kinase activity"|PF01202|IPR000623| GO:PFM GO:0005524|"GO:ATP binding"|PF01202|IPR000623| RP:SCP:NREP 1 RP:SCP:REP 1->159|1knqA|3e-25|46.2|158/171|c.37.1.17| HM:SCP:REP 1->162|3adkA_|3.3e-22|25.9|162/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 578 OP:NHOMOORG 469 OP:PATTERN -------------------------------------------------------------------- 11--2111111111111----1--11-----111111222----11--121-2321-1----11-1121111---111--------------------------1-1-------------------------------------1-111111--------------11111--------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------2111111111111----------1-11-12-1111--111321122212-11-1--1-------1111111112211-------------------------------------1-----1111111111111121111121111111--1111-1111111---------1-1111111--------------------------------1-11-----------------------------112--11-112-1111----------1----------------11211112112221212-1121212122112222221121111112222222222212122211111121-222222222222---------------111111111-----11111111111---2111111111111111111----------1-1-1111111111--11111111-------------------------------------------------------------1- ----111-2---1111111221222221111-111-11111-111111332232211112221111111111111111-111111111-12111111111111111-1-1---11--1--11111111-461-112111-111--11111111111112---111------1111-1--4----111-1111------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 163 STR:RPRED 100.0 SQ:SECSTR EEEcTTccHHHHHHHHHccccEEEEccHHHHHHHcTTHHTTTccccHHHHHHHHHHHHHHHHHHHTTcEEEEccccccHHHHHHHHHHHTcEEEEEEEccccccHHHHHHHTTcEEEEEEEcccccccccHHHHcccEEEccccccHHHHHHHHHHHHHHTTc DISOP:02AL 162-164| PSIPRED ccccccccHHHHHHHHHHHHccEEEEccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHHccc //